SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g04980): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g04980): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g04980

Feature Type:gene_model
Chromosome:Gm20
Start:5510098
stop:5510950
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g04980
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G27450AT Annotation by Michelle Graham. TAIR10: Aluminium induced protein with YGL and LRDR motifs | chr4:13727665-13728683 REVERSE LENGTH=250 SoyBaseE_val: 3.00E-61ISS
GO:0001666GO-bp Annotation by Michelle Graham. GO Biological Process: response to hypoxia SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF12481PFAM Aluminium induced protein JGI ISS
PF12504PFAM Aluminium induced protein JGI ISS
UniRef100_G7IP19UniRef Annotation by Michelle Graham. Most informative UniRef hit: Asparagine synthetase n=1 Tax=Medicago truncatula RepID=G7IP19_MEDTR SoyBaseE_val: 4.00E-89ISS
UniRef100_I1NDQ7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NDQ7_SOYBN SoyBaseE_val: 5.00E-128ISS

Expression Patterns of Glyma20g04980
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g04980 not represented in the dataset
Glyma20g04980 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g04980 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g037000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g04980
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g04980
>Glyma20g04980.2   sequence type=CDS   gene model=Glyma20g04980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGGGATTTTTCAAGGAGAAGTTGGTTAAAGCACCCAAAGAGGTGAACAATCCAGCTTCTTTGAATTCATGCAGCAAGCCTAAGCCAAGTCATGAAATCCTGAAGGATTTCATGCCCTACAATTCCTCCAATGCTTTCTCCATGTGCTTTGGGAATGATGCTTTGTTAGCCTATTCCCCTTTAAACAAGCCCTTCATTCATCATAGTGGTTTGGATAACATATATTGTGTCTTCCTGGGTGGCTTGCACAACCTTAGCATGGTCAATAAGCAGTATGGTCTATCAAAGGGAACAAATGAGGCCATTTTTATCACTAAAGTGTATCGAACTCTTCACGACAGGGGTCCACACCCTGCTGATCAGGTCGTCGAGGAACTTGAAGGTAGTTTCGATTTCATCTGTAACTCTCTAATTTCTCGATCTATGCATGGCAATGTGTGGTTTGGCTATCATGGTTCTAATGGCCAGATTGGGCTCTACTGGGGTGTTGCAACTGATAGTTCCATAGTTATTTCTGAAAATCTGGAGCTTATAAAAGCAAGCTGTGCTAAATCATTTGCACCATTTCCAACTGGTATGTAA
Predicted protein sequences of Glyma20g04980
>Glyma20g04980.2   sequence type=predicted peptide   gene model=Glyma20g04980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLGFFKEKLVKAPKEVNNPASLNSCSKPKPSHEILKDFMPYNSSNAFSMCFGNDALLAYSPLNKPFIHHSGLDNIYCVFLGGLHNLSMVNKQYGLSKGTNEAIFITKVYRTLHDRGPHPADQVVEELEGSFDFICNSLISRSMHGNVWFGYHGSNGQIGLYWGVATDSSIVISENLELIKASCAKSFAPFPTGM*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo