Glyma20g04946 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g04946): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g04946): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g04946

Feature Type:	gene_model
Chromosome:	Gm20
Start:	5435914
stop:	5436806
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g04946

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G26970	AT	Annotation by Michelle Graham. TAIR10: aconitase 2 \| chr4:13543077-13548427 FORWARD LENGTH=995	SoyBase	E_val: 8.00E-14	ISS
GO:0006094	GO-bp	Annotation by Michelle Graham. GO Biological Process: gluconeogenesis	SoyBase	N/A	ISS
GO:0006096	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycolysis	SoyBase	N/A	ISS
GO:0006101	GO-bp	Annotation by Michelle Graham. GO Biological Process: citrate metabolic process	SoyBase	N/A	ISS
GO:0006102	GO-bp	Annotation by Michelle Graham. GO Biological Process: isocitrate metabolic process	SoyBase	N/A	ISS
GO:0006487	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein N-linked glycosylation	SoyBase	N/A	ISS
GO:0006979	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to oxidative stress	SoyBase	N/A	ISS
GO:0007010	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization	SoyBase	N/A	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0009060	GO-bp	Annotation by Michelle Graham. GO Biological Process: aerobic respiration	SoyBase	N/A	ISS
GO:0010167	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to nitrate	SoyBase	N/A	ISS
GO:0010498	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process	SoyBase	N/A	ISS
GO:0015706	GO-bp	Annotation by Michelle Graham. GO Biological Process: nitrate transport	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003994	GO-mf	Annotation by Michelle Graham. GO Molecular Function: aconitate hydratase activity	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0051539	GO-mf	Annotation by Michelle Graham. GO Molecular Function: 4 iron, 4 sulfur cluster binding	SoyBase	N/A	ISS
PF00330	PFAM	Aconitase family (aconitate hydratase)	JGI		ISS
UniRef100_D3GQL1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Aconitate hydratase 3 n=1 Tax=Citrus clementina RepID=D3GQL1_9ROSI	SoyBase	E_val: 3.00E-11	ISS
UniRef100_UPI000233740B	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233740B related cluster n=1 Tax=unknown RepID=UPI000233740B	SoyBase	E_val: 3.00E-13	ISS

Expression Patterns of Glyma20g04946

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g04946 not represented in the dataset	Glyma20g04946 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g04946 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g036700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g04946

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g04946

Limit To All Plant Sequences

>Glyma20g04946.1   sequence type=CDS   gene model=Glyma20g04946   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGGAACTGATTCACACATAACTATGATTGATGGCCTGGGTGTTGCTGGATGGGGAGTTGGTGGAATAGAAGCACAAGCTGCAATGCTTGGCCAGAATAGGAGGAGGAGGAGGACCCTGGGTGGGATGACATTGAGGATCTTAGCAGTATTGATGAAAATAAAACAAGGCAGTAGAGTGGTGGTGGCGCAAGCAAAGTTGATTTGTGGAAGCGGCTTAGCGCTACAGAACAAGGGGAAGACTTGA

Predicted protein sequences of Glyma20g04946

Limit To All Plant Sequences

>Glyma20g04946.1   sequence type=predicted peptide   gene model=Glyma20g04946   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAGTDSHITMIDGLGVAGWGVGGIEAQAAMLGQNRRRRRTLGGMTLRILAVLMKIKQGSRVVVAQAKLICGSGLALQNKGKT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain