Glyma20g04820 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g04820): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g04820): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g04820

Feature Type:	gene_model
Chromosome:	Gm20
Start:	5205769
stop:	5208327
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g04820

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G02990	AT	Annotation by Michelle Graham. TAIR10: ribonuclease 1 \| chr2:873714-874667 FORWARD LENGTH=230	SoyBase	E_val: 4.00E-112	ISS
GO:0006865	GO-bp	Annotation by Michelle Graham. GO Biological Process: amino acid transport	SoyBase	N/A	ISS
GO:0007568	GO-bp	Annotation by Michelle Graham. GO Biological Process: aging	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009718	GO-bp	Annotation by Michelle Graham. GO Biological Process: anthocyanin-containing compound biosynthetic process	SoyBase	N/A	ISS
GO:0015824	GO-bp	Annotation by Michelle Graham. GO Biological Process: proline transport	SoyBase	N/A	ISS
GO:0016036	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
GO:0004521	GO-mf	Annotation by Michelle Graham. GO Molecular Function: endoribonuclease activity	SoyBase	N/A	ISS
GO:0004540	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ribonuclease activity	SoyBase	N/A	ISS
GO:0033897	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ribonuclease T2 activity	SoyBase	N/A	ISS
KOG1642	KOG	Ribonuclease, T2 family	JGI		ISS
PTHR11240	Panther	RIBONUCLEASE T2	JGI		ISS
PF00445	PFAM	Ribonuclease T2 family	JGI		ISS
UniRef100_C6SW07	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SW07_SOYBN	SoyBase	E_val: 2.00E-168	ISS
UniRef100_G7KFA3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ribonuclease T2 n=1 Tax=Medicago truncatula RepID=G7KFA3_MEDTR	SoyBase	E_val: 9.00E-136	ISS

Expression Patterns of Glyma20g04820

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g04820 not represented in the dataset	Glyma20g04820 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g04820 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g036100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g04820

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g04820

Limit To All Plant Sequences

>Glyma20g04820.1   sequence type=CDS   gene model=Glyma20g04820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAATCTAAAGAGTCCATCTTTGTGAAGCTTTTGCTGATTCTGCATTTGTCCGTTCTCTGTGTTTCACAGGATTTTGATTTCTACTACTTTGTTCAGCAGTGGCCAGGATCATATTGTGACACGACACAGAACAGCTGTTGCTACCCTACAACTGGAAAACCCGCTGCAGATTTTGGCATTCATGGGCTTTGGCCTAATTACAAAGATGGTTCATACCCATCTAACTGTGATTCAAACAATCGTTTTCAGCCATCTCAGATATCAGACCTCACTAGTAGCTTGCAGAGGAACTGGCCCACACTAGCATGCCCAAGTGGGAATGGGGTTCAATTCTGGACCCACGAATGGGAGAAACACGGCACTTGCTCTCAGTCAGTCCTTAAACAACATGACTATTTTGAAACAGCTCTCGATCTCAAGCAGAGAGCCAACCTCCTCCAAGCTCTTACAAATGCTGGAATACAACCAGATGGAGGGTTTTACAGCCTAAGCAGCATCAAGGGAGCTATAAAGAATGCAATTGGGTATACTCCATATATTGAGTGCAATGTGGACACATCACGTAACAACCAGCTTTACCAAGTTTACTTGTGTGTGGACACCTCGGGCTCTAACTTCATTGAATGCCCTGTGTTCCCTAGAGGGAAATGTGGCTCCCAAGTTGAGTTCCCAACTTTCTAA

Predicted protein sequences of Glyma20g04820

Limit To All Plant Sequences

>Glyma20g04820.1   sequence type=predicted peptide   gene model=Glyma20g04820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MESKESIFVKLLLILHLSVLCVSQDFDFYYFVQQWPGSYCDTTQNSCCYPTTGKPAADFGIHGLWPNYKDGSYPSNCDSNNRFQPSQISDLTSSLQRNWPTLACPSGNGVQFWTHEWEKHGTCSQSVLKQHDYFETALDLKQRANLLQALTNAGIQPDGGFYSLSSIKGAIKNAIGYTPYIECNVDTSRNNQLYQVYLCVDTSGSNFIECPVFPRGKCGSQVEFPTF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain