Glyma20g04711 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g04711

Feature Type:	gene_model
Chromosome:	Gm20
Start:	4990243
stop:	4990836
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g04711

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G49540	AT	Annotation by Michelle Graham. TAIR10: Rab5-interacting family protein \| chr5:20104804-20105609 REVERSE LENGTH=114	SoyBase	E_val: 1.00E-23	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0030244	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process	SoyBase	N/A	ISS
GO:0048193	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF07019	PFAM	Rab5-interacting protein (Rab5ip)	JGI		ISS
UniRef100_G7IUB6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Transmembrane protein n=1 Tax=Medicago truncatula RepID=G7IUB6_MEDTR	SoyBase	E_val: 4.00E-32	ISS
UniRef100_UPI000233E27F	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E27F related cluster n=1 Tax=unknown RepID=UPI000233E27F	SoyBase	E_val: 7.00E-53	ISS

Expression Patterns of Glyma20g04711

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g04711 not represented in the dataset	Glyma20g04711 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g04711 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g035600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g04711

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g04711

Limit To All Plant Sequences

>Glyma20g04711.1   sequence type=CDS   gene model=Glyma20g04711   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTGTACATTCTGATTTGGCTTCATTAGAGAAGAAATCTAGCAATGTTGTGAATGAGTTGCTGACTTTTAATGCTGAGAACATGCAAAGCCACATGAAAATTATATATTACAGCCGAACATTTTTATCTATAATTGGTGGAGTTGTTGCTGGTATTTTGGGATTTGCAGACTTGAAAGGATTTGTGTTTTACTTACTTCTCATGTCATTTACTTCACTTGGGCTCATGGCCAAAGCAAAGTTTTACAGGCTTGAATTATGGTTACTTGCAACTTTGTTTTCAATTTTATAG

Predicted protein sequences of Glyma20g04711

Limit To All Plant Sequences

>Glyma20g04711.1   sequence type=predicted peptide   gene model=Glyma20g04711   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVVHSDLASLEKKSSNVVNELLTFNAENMQSHMKIIYYSRTFLSIIGGVVAGILGFADLKGFVFYLLLMSFTSLGLMAKAKFYRLELWLLATLFSIL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain