Glyma20g04660 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g04660): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g04660): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g04660

Feature Type:	gene_model
Chromosome:	Gm20
Start:	4972994
stop:	4973239
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g04660

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G62260	AT	Annotation by Michelle Graham. TAIR10: Protein phosphatase 2C family protein \| chr3:23038516-23040391 REVERSE LENGTH=383	SoyBase	E_val: 8.00E-17	ISS
GO:0006470	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein dephosphorylation	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0008287	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: protein serine/threonine phosphatase complex	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004722	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine phosphatase activity	SoyBase	N/A	ISS
PTHR13832	Panther	PROTEIN PHOSPHATASE 2C	JGI		ISS
PTHR13832:SF92	Panther	PROTEIN PHOSPHATASE 2C	JGI		ISS
PF00481	PFAM	Protein phosphatase 2C	JGI		ISS
UniRef100_G7JHS4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DNA-binding protein phosphatase 2C n=1 Tax=Medicago truncatula RepID=G7JHS4_MEDTR	SoyBase	E_val: 4.00E-26	ISS
UniRef100_I1MTZ9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MTZ9_SOYBN	SoyBase	E_val: 6.00E-32	ISS

Expression Patterns of Glyma20g04660

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g04660 not represented in the dataset	Glyma20g04660 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g04660 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g035500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g04660

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g04660

Limit To All Plant Sequences

>Glyma20g04660.1   sequence type=CDS   gene model=Glyma20g04660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCCAAAGATCACTGGCCATTGTGCATTAAGGAAAGAAAGAGGATTGAGTCTCTAGGTGGATACATAGATGATGGTTACCTGAACGACCAGTTAGGAATGAAGGAAATTAATGGAAAGGGTGAACCATTGAGTGCTGAGCCTAAAATTAAGTTAATCACACTGACAAAAGAAGATGAATTCTTCATAATTGGGAATGATGGGATCTAG

Predicted protein sequences of Glyma20g04660

Limit To All Plant Sequences

>Glyma20g04660.1   sequence type=predicted peptide   gene model=Glyma20g04660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSKDHWPLCIKERKRIESLGGYIDDGYLNDQLGMKEINGKGEPLSAEPKIKLITLTKEDEFFIIGNDGI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain