Glyma20g04560 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g04560): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g04560): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g04560

Feature Type:	gene_model
Chromosome:	Gm20
Start:	4773445
stop:	4777094
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g04560

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G08750	AT	Annotation by Michelle Graham. TAIR10: Peptidase C13 family \| chr1:2801283-2804392 FORWARD LENGTH=388	SoyBase	E_val: 7.00E-95	ISS
GO:0006508	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis	SoyBase	N/A	ISS
GO:0016126	GO-bp	Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process	SoyBase	N/A	ISS
GO:0046520	GO-bp	Annotation by Michelle Graham. GO Biological Process: sphingoid biosynthetic process	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0003923	GO-mf	Annotation by Michelle Graham. GO Molecular Function: GPI-anchor transamidase activity	SoyBase	N/A	ISS
GO:0004197	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cysteine-type endopeptidase activity	SoyBase	N/A	ISS
PTHR12000	Panther	HEMOGLOBINASE FAMILY MEMBER	JGI		ISS
PTHR12000:SF1	Panther	GPI-ANCHOR TRANSAMIDASE	JGI		ISS
PF01650	PFAM	Peptidase C13 family	JGI		ISS
UniRef100_G7IQL5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: GPI-anchor transamidase n=1 Tax=Medicago truncatula RepID=G7IQL5_MEDTR	SoyBase	E_val: 5.00E-94	ISS
UniRef100_UPI000233DAF6	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233DAF6 related cluster n=1 Tax=unknown RepID=UPI000233DAF6	SoyBase	E_val: 4.00E-128	ISS

Expression Patterns of Glyma20g04560

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g04560 not represented in the dataset	Glyma20g04560 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g04560 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g034600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g04560

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g04560

Limit To All Plant Sequences

>Glyma20g04560.2   sequence type=CDS   gene model=Glyma20g04560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTGTTTGCCTGCAATGGCTCAGGTACTTACAGGACGTCATGAAACTTCTGTTCCATGATTGTTTGCCTGCAAGGGCTCAGGTAGATTATCGTGGCTATGAAGTAACAGTGGAAAACTTTTTACGGGTACTTACAGGACGTCATGAAACTTCTGTTCCAAGGTCCAAGAGTCTTCTTAGTGATGAAGGAAGTCATATTCTTCTGTATATGACAGGGCACGGGGGTGATGAGTTTTTGAAGTTTCAGGACTCAGAAGAGCTTCAAAGTCATGATTTAGCTGATGTTGTGAAGCAAATGAAAGAGAAGCATAGGTTTAAGGAGCTTCTAATAATGGTGGACACCTGCCAAGCCTCTACCCTGTTCTGCCAGCTTCATTCGCCAGGTGTTTTGGCAATTGGAAGTAGTATGAAAGGAGAGAATTCATATTCACCTCATTTGGACTCAGATGTTGGTGTTTCAGTTGTTGATCGCTTTACATTTTACACTCTTGCTTTCTTTGAGAGGCTGAATATGAATGACAATGCTTCATTGAGCGGGTACATTCAAACTTCTTATAAGCCTTTTCACATTAAGTATTTAATCCTTGCTATCAAGTGTCTATAG

Predicted protein sequences of Glyma20g04560

Limit To All Plant Sequences

>Glyma20g04560.2   sequence type=predicted peptide   gene model=Glyma20g04560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIVCLQWLRYLQDVMKLLFHDCLPARAQVDYRGYEVTVENFLRVLTGRHETSVPRSKSLLSDEGSHILLYMTGHGGDEFLKFQDSEELQSHDLADVVKQMKEKHRFKELLIMVDTCQASTLFCQLHSPGVLAIGSSMKGENSYSPHLDSDVGVSVVDRFTFYTLAFFERLNMNDNASLSGYIQTSYKPFHIKYLILAIKCL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain