SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g04470): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g04470): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g04470

Feature Type:gene_model
Chromosome:Gm20
Start:4610139
stop:4612310
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g04470
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G15290AT Annotation by Michelle Graham. TAIR10: Uncharacterised protein family (UPF0497) | chr5:4967094-4967846 FORWARD LENGTH=187 SoyBaseE_val: 1.00E-61ISS
GO:0007043GO-bp Annotation by Michelle Graham. GO Biological Process: cell-cell junction assembly SoyBaseN/AISS
GO:0042545GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall modification SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0048226GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Casparian strip SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0042803GO-mf Annotation by Michelle Graham. GO Molecular Function: protein homodimerization activity SoyBaseN/AISS
PTHR11615Panther NITRATE, FROMATE, IRON DEHYDROGENASE JGI ISS
PTHR11615:SF54Panther SUBFAMILY NOT NAMED JGI ISS
PF04535PFAM Domain of unknown function (DUF588) JGI ISS
UniRef100_C6T4A0UniRef Annotation by Michelle Graham. Best UniRef hit: CASP-like protein 2 n=1 Tax=Glycine max RepID=CSPL2_SOYBN SoyBaseE_val: 1.00E-130ISS
UniRef100_C6T4A0UniRef Annotation by Michelle Graham. Most informative UniRef hit: CASP-like protein 2 n=1 Tax=Glycine max RepID=CSPL2_SOYBN SoyBaseE_val: 1.00E-130ISS

Expression Patterns of Glyma20g04470
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g04470 not represented in the dataset
Glyma20g04470 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g04470 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g033800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g04470
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g04470
>Glyma20g04470.1   sequence type=CDS   gene model=Glyma20g04470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGGCCGGTGCAGTTGAGTCTGGTGAAATTTCAAAAGGAGCACCCCCAAGAAAAGGGTTGATTAGAGGGCTCTCAATAATGGACTTTATTTTGAGAATTGTTGCAGCCATTGCCACACTCGGAAGTGCATTGGGTATGGGAACAACTAGGCAAACACTTCCATTTTCCACCCAGTTTGTAAAATTCAGAGCTGTATTTAGTGATGTTCCCACATTCGTGTTTTTTGTGACCTCCAATTCTATTGTATGTGGCTACCTAGTTCTTTCACTTGTTCTGTCATTCTTCCACATAGTAAGGAGTGCTGCAGTCAAAAGCAGGGTACTCCAGGTCTTTCTTGACACGGTTATGTATGGTCTTCTCACAACTGGAGCCTCAGCAGCAACAGCAATAGTCTATGAAGCACACTATGGCAACTCAAATACCAATTGGTTTCCATTCTGCAGACAATACAACCATTTCTGTAAACAAATTTCTGGTTCACTCATTGGCTCTTTCATTGCAGTAGTTCTCTTCATCATACTTATTCTCATGTCAGCAATATCAATAAGCAAGCATTAA
Predicted protein sequences of Glyma20g04470
>Glyma20g04470.1   sequence type=predicted peptide   gene model=Glyma20g04470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKAGAVESGEISKGAPPRKGLIRGLSIMDFILRIVAAIATLGSALGMGTTRQTLPFSTQFVKFRAVFSDVPTFVFFVTSNSIVCGYLVLSLVLSFFHIVRSAAVKSRVLQVFLDTVMYGLLTTGASAATAIVYEAHYGNSNTNWFPFCRQYNHFCKQISGSLIGSFIAVVLFIILILMSAISISKH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo