SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g04400

Feature Type:gene_model
Chromosome:Gm20
Start:4538066
stop:4540167
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g04400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G69490AT Annotation by Michelle Graham. TAIR10: NAC-like, activated by AP3/PI | chr1:26122233-26123222 FORWARD LENGTH=268 SoyBaseE_val: 3.00E-108ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0007275GO-bp Annotation by Michelle Graham. GO Biological Process: multicellular organismal development SoyBaseN/AISS
GO:0009617GO-bp Annotation by Michelle Graham. GO Biological Process: response to bacterium SoyBaseN/AISS
GO:0009825GO-bp Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth SoyBaseN/AISS
GO:0009908GO-bp Annotation by Michelle Graham. GO Biological Process: flower development SoyBaseN/AISS
GO:0010150GO-bp Annotation by Michelle Graham. GO Biological Process: leaf senescence SoyBaseN/AISS
GO:0045087GO-bp Annotation by Michelle Graham. GO Biological Process: innate immune response SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF02365PFAM No apical meristem (NAM) protein JGI ISS
UniRef100_I1NDN7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1NDN7_SOYBN SoyBaseE_val: 4.00E-179ISS
UniRef100_Q93XA6UniRef Annotation by Michelle Graham. Most informative UniRef hit: NAC domain protein NAC2 n=1 Tax=Phaseolus vulgaris RepID=Q93XA6_PHAVU SoyBaseE_val: 1.00E-164ISS

Proteins Associated with Glyma20g04400
LocusGene SymbolProtein Name
NAC148 NAC Transcription Factor gene 148

Expression Patterns of Glyma20g04400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g04400 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g033300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g04400
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g04400
>Glyma20g04400.2   sequence type=CDS   gene model=Glyma20g04400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGGTGGCACAACAAGCTCTGAACTCCCCCCTGGCTTTAGGTTTCATCCAACGGATGAGGAACTGATTGTGTATTACCTTTGTAACCAAGCCACCTCAAAGCCATGCCCTGCATCTATCATCCCAGAAGTGGATCTCTATAAGTTTGATCCATGGGAATTGCCAGATAAAACAGAATTTGGAGAAAATGAATGGTATTTCTTTACTCCAAGAGACAGGAAGTACCCAAATGGGGTGAGGCCTAACCGAGCAACCGTGTCAGGGTATTGGAAGGCTACTGGCACAGACAAGGCAATCTACAGTGGATCTAAGCATGTAGGGGTGAAGAAATCTTTAGTCTTTTACAAGGGTAGGCCACCAAAGGGTGCCAAGACAGATTGGATCATGCATGAGTATCGATTGGCTGAATCAAAAATACCATCTAGCAGGAAAATTGGATCCATGAGGCTGGATGACTGGGTCTTGTGCAGGATCTATAAGAAGAAGAGCATGGTAAAGGCATTGGAGCACAAAGAGGCACAGCCTAAAGTCCAAATTGCTAATCTTGCAGCTGCAAATCAAGATGTTGAACAGAAAATGATGAACCTTCCTAGGACTTGGTCCCTTGCTTACCTTTTGGATATGAATTACTTGGGTCCAATTTTATCTGATGGCTCTTATTGCCCAACCTTAGATTTTCAAATTAACAATGCCAATATTGAATTTGACCCTTTTGTGAAATCTCAACCGGTTGAAATGAACTACAATTATGAAGCAGATTCAGGGAAGTACCAAGTGAAACAGAGTAGCACCATTGACCAACCCATATATGTGAAACAAATGTATGATTTGCTAGGATAA
Predicted protein sequences of Glyma20g04400
>Glyma20g04400.2   sequence type=predicted peptide   gene model=Glyma20g04400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGGTTSSELPPGFRFHPTDEELIVYYLCNQATSKPCPASIIPEVDLYKFDPWELPDKTEFGENEWYFFTPRDRKYPNGVRPNRATVSGYWKATGTDKAIYSGSKHVGVKKSLVFYKGRPPKGAKTDWIMHEYRLAESKIPSSRKIGSMRLDDWVLCRIYKKKSMVKALEHKEAQPKVQIANLAAANQDVEQKMMNLPRTWSLAYLLDMNYLGPILSDGSYCPTLDFQINNANIEFDPFVKSQPVEMNYNYEADSGKYQVKQSSTIDQPIYVKQMYDLLG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo