SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g04044): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g04044): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g04044

Feature Type:gene_model
Chromosome:Gm20
Start:4139705
stop:4139950
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G40540AT Annotation by Michelle Graham. TAIR10: potassium transporter 2 | chr2:16931445-16934516 FORWARD LENGTH=794 SoyBaseE_val: 4.00E-31ISS
GO:0000394GO-bp Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation SoyBaseN/AISS
GO:0006813GO-bp Annotation by Michelle Graham. GO Biological Process: potassium ion transport SoyBaseN/AISS
GO:0009086GO-bp Annotation by Michelle Graham. GO Biological Process: methionine biosynthetic process SoyBaseN/AISS
GO:0010075GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth SoyBaseN/AISS
GO:0071805GO-bp Annotation by Michelle Graham. GO Biological Process: potassium ion transmembrane transport SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0015079GO-mf Annotation by Michelle Graham. GO Molecular Function: potassium ion transmembrane transporter activity SoyBaseN/AISS
PF02705PFAM K+ potassium transporter JGI ISS
UniRef100_Q06XL8UniRef Annotation by Michelle Graham. Most informative UniRef hit: KUP2 n=1 Tax=Vitis vinifera RepID=Q06XL8_VITVI SoyBaseE_val: 4.00E-29ISS
UniRef100_UPI0002337705UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337705 related cluster n=1 Tax=unknown RepID=UPI0002337705 SoyBaseE_val: 4.00E-35ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g04044 not represented in the dataset

Glyma20g04044 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g032100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma20g04044.1   sequence type=CDS   gene model=Glyma20g04044   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGGAAGAGTTGGAAGATCTTTATGCTGCTCAAGAAGCTGGGATTGCCTTCATTCTAGGGCATTCTCATGTAAGAGCAAAGCAAGGCTCATCTGTACTAAAAAAGTTGGCACTTAACTATGGCTACAATTTCTTGAGAAGGATTTGTAAAGGCCTTGATGTTGCACTTAAGGTTCCCCTAGTTTCGCTTTCGGAAGTTGGCATGGTTTATAGTTAA

>Glyma20g04044.1   sequence type=predicted peptide   gene model=Glyma20g04044   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQEELEDLYAAQEAGIAFILGHSHVRAKQGSSVLKKLALNYGYNFLRRICKGLDVALKVPLVSLSEVGMVYS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo