SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g03820

Feature Type:gene_model
Chromosome:Gm20
Start:3693534
stop:3694782
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g03820
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G15130AT Annotation by Michelle Graham. TAIR10: WRKY DNA-binding protein 72 | chr5:4904426-4906879 FORWARD LENGTH=548 SoyBaseE_val: 3.00E-44ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
PF03106PFAM WRKY DNA -binding domain JGI ISS
UniRef100_B9S2A5UniRef Annotation by Michelle Graham. Most informative UniRef hit: WRKY transcription factor, putative n=1 Tax=Ricinus communis RepID=B9S2A5_RICCO SoyBaseE_val: 2.00E-54ISS
UniRef100_I1JBP3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JBP3_SOYBN SoyBaseE_val: 3.00E-93ISS

Proteins Associated with Glyma20g03820
LocusGene SymbolProtein Name
WRKY181 WRKY Transcription Factor

Expression Patterns of Glyma20g03820
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g03820 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g030500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g03820
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g03820
>Glyma20g03820.2   sequence type=CDS   gene model=Glyma20g03820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATGATGGGTGCCATTGGAGAAAATATGGACAGAAAATGGCCAAAGGAAATCCATGCCCCCGAGCTTACTATCGATGCACTGCTTCTCCATCTTGTCTAGTAAGAAAACAAGTGCAAAGATGTGCTGAAGAAATGTCCATATTGATTACCACCTATGAAGGAACTCACAATCACCCTCTTCCTATGTCAGCCACTACAATGGCCTGCACAACTTCTGCTGCAGCTTCCATGCTCCAATCTCCCTCATTGAGTTCACAACATGGATTAGTTGATTCAGCTATATCCTCCATCATCAACTCTAGTGATCCTTATTACAACCCTAATAATGCTCTAAACTTCTCGACACACCAAGTTTCAAGACCACAACAATTCTACTTCCCCAACTCATCCATTTCAACCTTGAATTCTCACCCCACAATCACTTTAGACCTTACAACACCTCCAACTTCTTCCTCAAACTCAAGCTTCACTTGCATGCCAAAATACTGA
Predicted protein sequences of Glyma20g03820
>Glyma20g03820.2   sequence type=predicted peptide   gene model=Glyma20g03820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNDGCHWRKYGQKMAKGNPCPRAYYRCTASPSCLVRKQVQRCAEEMSILITTYEGTHNHPLPMSATTMACTTSAAASMLQSPSLSSQHGLVDSAISSIINSSDPYYNPNNALNFSTHQVSRPQQFYFPNSSISTLNSHPTITLDLTTPPTSSSNSSFTCMPKY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo