Glyma20g03693 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g03693): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g03693): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g03693

Feature Type:	gene_model
Chromosome:	Gm20
Start:	3531810
stop:	3532602
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g03693

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G47960	AT	Annotation by Michelle Graham. TAIR10: cell wall / vacuolar inhibitor of fructosidase 1 \| chr1:17681954-17683516 REVERSE LENGTH=205	SoyBase	E_val: 6.00E-37	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0004857	GO-mf	Annotation by Michelle Graham. GO Molecular Function: enzyme inhibitor activity	SoyBase	N/A	ISS
GO:0030599	GO-mf	Annotation by Michelle Graham. GO Molecular Function: pectinesterase activity	SoyBase	N/A	ISS
GO:0046910	GO-mf	Annotation by Michelle Graham. GO Molecular Function: pectinesterase inhibitor activity	SoyBase	N/A	ISS
PF04043	PFAM	Plant invertase/pectin methylesterase inhibitor	JGI		ISS
UniRef100_G7JPZ3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Pectinesterase inhibitor n=1 Tax=Medicago truncatula RepID=G7JPZ3_MEDTR	SoyBase	E_val: 1.00E-51	ISS
UniRef100_UPI000233DB4C	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233DB4C related cluster n=1 Tax=unknown RepID=UPI000233DB4C	SoyBase	E_val: 6.00E-123	ISS

Expression Patterns of Glyma20g03693

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g03693 not represented in the dataset	Glyma20g03693 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g03693 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g029700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g03693

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g03693

Limit To All Plant Sequences

>Glyma20g03693.1   sequence type=CDS   gene model=Glyma20g03693   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTATCTCTCCAAGCAATTCTCTACTTAAGGCTGAAAGAACAGGAAGCTCCACAACCACAGTGCACTTGATTTCAATTTCTATTCCCCAACTTCAATTTTTGAGCCTTCTATATATCATCCATCGTATTCTAACAAAGATGCTGAACTTGAAGCACCTCTCTATAATTTGCAGCATTCTTGTTGTGGCTATCATTTCAATGTCAGCATGTCATTGCAGAGTTTTGCAACCAAATGATTTGAAACTCATTGAGGAAACTTGCAAGAGAACCCCAAATCCTAATCTTTGTCTTCAACTCCTAAAAGCTGACCCCCGTGCCCCTAGCGCTGATATTGCAGGCCTTGCATTGATTTTGGTCGATGTGATCAAAGCCAAAGCAACCGAAGCCGAGAAAACAATCAAGCAACTTCTTAAGCAGGGTGGGAATAAGAAAGCCTTAAGTGAATGTGCTGACGATTACGATGGGATTTTGAAGCTTGATGTGCCAACTGCCACTAGGGCTGTGAGGGGAAACCCCAAATTTGCAGAAAATGCGGTAAGTGACTGTGCTGTTGAGGCTGATTCTTGTGAGAATGGCTTCCATGGGAAATCACCACTCACCCATGTGAATAATGGTATGCATGATGTGGCGAATGTGGCAAGGGCTATTATTAGGAATTTGCTCTAG

Predicted protein sequences of Glyma20g03693

Limit To All Plant Sequences

>Glyma20g03693.1   sequence type=predicted peptide   gene model=Glyma20g03693   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIISPSNSLLKAERTGSSTTTVHLISISIPQLQFLSLLYIIHRILTKMLNLKHLSIICSILVVAIISMSACHCRVLQPNDLKLIEETCKRTPNPNLCLQLLKADPRAPSADIAGLALILVDVIKAKATEAEKTIKQLLKQGGNKKALSECADDYDGILKLDVPTATRAVRGNPKFAENAVSDCAVEADSCENGFHGKSPLTHVNNGMHDVANVARAIIRNLL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain