|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G27030 | AT | Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF3339 (InterPro:IPR021775); BEST Arabidopsis thaliana protein match is: Protein of unknown function (DUF 3339) (TAIR:AT5G40970.1); Has 538 Blast hits to 271 proteins in 16 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 534; Viruses - 4; Other Eukaryotes - 0 (source: NCBI BLink). | chr3:9 | SoyBase | E_val: 9.00E-28 | ISS |
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| PF11820 | PFAM | Protein of unknown function (DUF3339) | JGI | ISS | |
| UniRef100_I1NDL1 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1NDL1_SOYBN | SoyBase | E_val: 1.00E-41 | ISS |
| UniRef100_Q9FLN2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Emb|CAB62355.1 n=1 Tax=Arabidopsis thaliana RepID=Q9FLN2_ARATH | SoyBase | E_val: 3.00E-24 | ISS |
|
Glyma20g03650 not represented in the dataset |
Glyma20g03650 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.20g029400 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma20g03650.1 sequence type=CDS gene model=Glyma20g03650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAGTGATTGGGCACCGGTGTTGAACGGGGTGGTTCTGTTCATGCTGCTCCAACCAGGGCTGCTTTTCTCCTTTCCTGGGAACGGGAAGCAGCTTGAGTTCGGTAGCATGAAGACCAATGACAAAGCTATTTTCATCCACACGTTCATCTTGTTCGCGCTCTACTATGTCCTCATCCTCGCCGTTAAAATCCATATCTACACCGGCTGA
>Glyma20g03650.1 sequence type=predicted peptide gene model=Glyma20g03650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MSDWAPVLNGVVLFMLLQPGLLFSFPGNGKQLEFGSMKTNDKAIFIHTFILFALYYVLILAVKIHIYTG*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||