|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G19730 | AT | Annotation by Michelle Graham. TAIR10: Ribosomal L28e protein family | chr2:8511752-8512995 FORWARD LENGTH=143 | SoyBase | E_val: 6.00E-16 | ISS |
| GO:0006412 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translation | SoyBase | N/A | ISS |
| GO:0042254 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis | SoyBase | N/A | ISS |
| GO:0005618 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cell wall | SoyBase | N/A | ISS |
| GO:0005622 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: intracellular | SoyBase | N/A | ISS |
| GO:0005840 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: ribosome | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0022625 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit | SoyBase | N/A | ISS |
| GO:0022626 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome | SoyBase | N/A | ISS |
| GO:0003735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome | SoyBase | N/A | ISS |
| PTHR10544 | Panther | 60S RIBOSOMAL PROTEIN L28 | JGI | ISS | |
| PF01778 | PFAM | Ribosomal L28e protein family | JGI | ISS | |
| UniRef100_C6T0W1 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T0W1_SOYBN | SoyBase | E_val: 4.00E-17 | ISS |
| UniRef100_G7IUL4 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L28-1 n=1 Tax=Medicago truncatula RepID=G7IUL4_MEDTR | SoyBase | E_val: 1.00E-16 | ISS |
|
Glyma20g03536 not represented in the dataset |
Glyma20g03536 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma20g03536.1 sequence type=CDS gene model=Glyma20g03536 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCTAACACTGTCAAATTTATAGAGAACTTCACAACTTGTGAGCTTCCTCTTCAAATTGAAGTTCCCAGTTCATGTGCTATAGTAGCCGATAACTACTACAGACCTGATCTCAAAAAGGCAGCTCTAGCAAGGTTGAGCGCTGTCAATAGGAGCCTCAGAGTTGCTAAGTCTGGTGTGAAGAAGAGGAACAGACAGGCTGGGGGGAGGGAATGA
>Glyma20g03536.1 sequence type=predicted peptide gene model=Glyma20g03536 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MANTVKFIENFTTCELPLQIEVPSSCAIVADNYYRPDLKKAALARLSAVNRSLRVAKSGVKKRNRQAGGRE*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||