Glyma20g03160 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g03160): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g03160): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g03160

Feature Type:	gene_model
Chromosome:	Gm20
Start:	2876977
stop:	2878835
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g03160

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G05780	AT	Annotation by Michelle Graham. TAIR10: RP non-ATPase subunit 8A \| chr5:1735862-1738176 FORWARD LENGTH=308	SoyBase	E_val: 6.00E-109	ISS
GO:0006511	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0009965	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis	SoyBase	N/A	ISS
GO:0042023	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication	SoyBase	N/A	ISS
GO:0043161	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0043248	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasome assembly	SoyBase	N/A	ISS
GO:0051510	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of unidimensional cell growth	SoyBase	N/A	ISS
GO:0051788	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to misfolded protein	SoyBase	N/A	ISS
GO:0080129	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly	SoyBase	N/A	ISS
GO:0000502	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proteasome complex	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0008541	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proteasome regulatory particle, lid subcomplex	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PTHR10540	Panther	EIF3F-RELATED	JGI		ISS
PTHR10540:SF7	Panther	26S PROTEASOME REGULATORY SUBUNIT-RELATED	JGI		ISS
PF00069	PFAM	Protein kinase domain	JGI		ISS
PF01398	PFAM	Mov34/MPN/PAD-1 family	JGI		ISS
UniRef100_G7JB60	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 26S proteasome regulatory particle non-ATPase subunit n=1 Tax=Medicago truncatula RepID=G7JB60_MEDTR	SoyBase	E_val: 1.00E-110	ISS
UniRef100_UPI000233DA86	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233DA86 related cluster n=1 Tax=unknown RepID=UPI000233DA86	SoyBase	E_val: 3.00E-163	ISS

Expression Patterns of Glyma20g03160

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g03160 not represented in the dataset	Glyma20g03160 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g03160 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g026100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g03160

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g03160

Limit To All Plant Sequences

>Glyma20g03160.2   sequence type=CDS   gene model=Glyma20g03160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ACAGTGCCCTTTGAAGAAGATGACAAGGATCCTAACATTTGGTTTCTTGACCATAATTACCATGAATCGATGTTTTCCATGTTTAAAAGAATAAATGGTATGAGTAGGAATTTTTTTCCTTTTCTTGAGCATGTTGTGGGGTGGTATAGCACTGGTCCAAAGTTGCGTGAAAATGACTTTGACACTCATGGGTTATTTAATGTCTATGTTCCAAATCCTGTCTTGGTTATAATTGATGTTGAACCTAAGGAATTAGGAATCCCAAGAAAAACATATTATGTCGTTGAAGAGGTTAAAGAGAAACTGACATATAGTTTATTCTGTGTACATAATGCCACTCAAAAAAGTCAAAAGGTATTTATACATGTGCCATCAGAGATTGCTACTAATGAAGTTGAGGAAATATTAGTGGAACACTTGCTTAGATATGTGAAGGATACAACCATTAGCATCCTTGTGACAAAGGTAAGTGCAAACCTCACAACCTTGAAGGGTTTGGATGCAAGACTTAAAGAGATCAGGGGTTTCTTTGACCTTGTTATTGATGGAAAGCTTCCATTAAACCATGAGATCCTGTACCATCTGCAAGACGTGTTTAACCTGTTACCAAATCTCAATGTTGTTGATCTTTTATCAAGGCTTTGGTATAGGGCTCCAGAACTTCTTTTGGGTTCAACTGATTATGGATTCAACATTGATCTCTGTAGTGCAGGATGCCTATTGGCTGAGATGCTTGTTGGAAGACCAATTATGCCTGGCAGGACAGGGGTACCAATTAGCTAA

Predicted protein sequences of Glyma20g03160

Limit To All Plant Sequences

>Glyma20g03160.2   sequence type=predicted peptide   gene model=Glyma20g03160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TVPFEEDDKDPNIWFLDHNYHESMFSMFKRINGMSRNFFPFLEHVVGWYSTGPKLRENDFDTHGLFNVYVPNPVLVIIDVEPKELGIPRKTYYVVEEVKEKLTYSLFCVHNATQKSQKVFIHVPSEIATNEVEEILVEHLLRYVKDTTISILVTKVSANLTTLKGLDARLKEIRGFFDLVIDGKLPLNHEILYHLQDVFNLLPNLNVVDLLSRLWYRAPELLLGSTDYGFNIDLCSAGCLLAEMLVGRPIMPGRTGVPIS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain