Report for Sequence Feature Glyma20g03120
Feature Type: gene_model
Chromosome: Gm20
Start: 2851713
stop: 2859108
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma20g03120
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G26480 AT
Annotation by Michelle Graham. TAIR10: general regulatory factor 12 | chr1:9156573-9157845 REVERSE LENGTH=268
SoyBase E_val: 3.00E-163 ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0019904 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein domain specific binding
SoyBase N/A ISS
GO:0045309 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein phosphorylated amino acid binding
SoyBase N/A ISS
KOG0841
KOG
Multifunctional chaperone (14-3-3 family)
JGI ISS
PTHR18860 Panther
14-3-3
JGI ISS
PF00244 PFAM
14-3-3 protein
JGI ISS
UniRef100_G7JHI0 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: 14-3-3-like protein n=1 Tax=Medicago truncatula RepID=G7JHI0_MEDTR
SoyBase E_val: 1.00E-170 ISS
UniRef100_I1NDI4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1NDI4_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma20g03120
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma20g03120
Paralog Evidence Comments
Glyma07g35240 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma20g03120 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.20g025900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma20g03120
Coding sequences of Glyma20g03120
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma20g03120.1 sequence type=CDS gene model=Glyma20g03120 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTCCACAGAGAAGGAGAGAGAGACCCAAGTTTACTTGGCCAAGCTCTCTGAGCAAGCCGAGAGATATGAAGAGATGGTTGAATGCATGAAGACAATTGCAAAACTTGATCTAGAACTAACTGTTGAAGAGAGGAACCTGCTCTCAGTGGGATATAAGAATGTGATTGGTGCAAGAAGAGCCTCTTGGCGCATTATGTCATCAATTGAACAAAAGGAAGAGTCTAAAGGAAATGAAAGCAATGCAAAACTGATAAAGAATTATCGTCAAAAGGTTGAAGAGGAACTCTCAAAGATTTGCAGTGACATTCTCAGCATTATTGACCAGCATCTTGTTCCTTCTTCCACCTCAGGAGAAGCCACCGTTTTCTACTATAAGATGAAAGGTGACTATTATCGATATTTAGCCGAGTTCAAGACCGATCAGGATAGAAAGGAGGCTGCTGAGCAATCACTAAAGGGATATGAGGCTGCTTTAGCTACAGCAAGCACAGAGCTTCCATCAACACATCCAATCCGTCTTGGACTTGCGCTCAACTTCTCAGTCTTCTATTATGAGATACTGAACTCTCCTGAAAGGGCCTGTCATTTGGCTAAGCAAGCTTTCGATGAGGCAATTGCAGAGTTAGACACCTTGAGTGAAGAGTCATACAAGGACAGCACTTTGATCATGCAGCTGCTGAGAGACAATCTCACTCTCTGGACCTCTGATTTACCTGAGGATGGAGGTGACGAAATTAAAACAGAAGAAGCCAAACCTGCTGAAACTTCTGAGCACTCATAG
Predicted protein sequences of Glyma20g03120
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma20g03120.1 sequence type=predicted peptide gene model=Glyma20g03120 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSTEKERETQVYLAKLSEQAERYEEMVECMKTIAKLDLELTVEERNLLSVGYKNVIGARRASWRIMSSIEQKEESKGNESNAKLIKNYRQKVEEELSKICSDILSIIDQHLVPSSTSGEATVFYYKMKGDYYRYLAEFKTDQDRKEAAEQSLKGYEAALATASTELPSTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDLPEDGGDEIKTEEAKPAETSEHS*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
