Glyma20g02400 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g02400

Feature Type:	gene_model
Chromosome:	Gm20
Start:	2048820
stop:	2052011
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g02400

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G35120	AT	Annotation by Michelle Graham. TAIR10: Single hybrid motif superfamily protein \| chr2:14805913-14807274 REVERSE LENGTH=156	SoyBase	E_val: 2.00E-86	ISS
GO:0006546	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycine catabolic process	SoyBase	N/A	ISS
GO:0009744	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus	SoyBase	N/A	ISS
GO:0009749	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to glucose stimulus	SoyBase	N/A	ISS
GO:0009750	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus	SoyBase	N/A	ISS
GO:0019464	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycine decarboxylation via glycine cleavage system	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005960	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: glycine cleavage complex	SoyBase	N/A	ISS
GO:0004375	GO-mf	Annotation by Michelle Graham. GO Molecular Function: glycine dehydrogenase (decarboxylating) activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
KOG3373	KOG	Glycine cleavage system H protein (lipoate-binding)	JGI		ISS
PTHR11715	Panther	GLYCINE CLEAVAGE SYSTEM H PROTEIN	JGI		ISS
PF01597	PFAM	Glycine cleavage H-protein	JGI		ISS
UniRef100_I1NDC6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NDC6_SOYBN	SoyBase	E_val: 5.00E-110	ISS
UniRef100_Q2MGQ2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 2-oxo acid dehydrogenase, lipoyl-binding site n=1 Tax=Medicago truncatula RepID=Q2MGQ2_MEDTR	SoyBase	E_val: 2.00E-92	ISS

Expression Patterns of Glyma20g02400

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g02400

Paralog	Evidence	Comments
Glyma07g34690	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g02400 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g019600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g02400

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g02400

Limit To All Plant Sequences

>Glyma20g02400.1   sequence type=CDS   gene model=Glyma20g02400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTGCAGGCAATTGTGGGCTTCAAGAGCTGCCTCTTACCTGAGGATCTCTGTGTTTCACAGAGGCTTTTCTAATGTTATTAAAGATTTCAAGTATGTTGATTCTCATGAGTGGGTGAAAGTTGATGGAAATTACGCAACCATCGGCATAACTGATCATGCCCAAGATCATTTGGGTGATGTTGTATATGTTGAATTGCCAGAAGTGGGAGCAGCTGTGACACAAGGAGGTAGTTTTGGTGCAGTTGAAAGTGTGAAGGCTACTAGTGATATTAACTCTCCTATTTCAGGAAAAGTTGTTGAAGTCAATGAAGCGCTTAACAGCTCTCCTGCTTTGGTCAATTCAAGCCCTTATAAAGATGGATGGATAATTAAAGTTGAAATAAATGACAGTGGTGAACTAAACAACTTGATGGATTCAGAACAATACTCCAAGTTCTGTGAAGAAGAAGATTCCAAGCACTGA

Predicted protein sequences of Glyma20g02400

Limit To All Plant Sequences

>Glyma20g02400.1   sequence type=predicted peptide   gene model=Glyma20g02400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MACRQLWASRAASYLRISVFHRGFSNVIKDFKYVDSHEWVKVDGNYATIGITDHAQDHLGDVVYVELPEVGAAVTQGGSFGAVESVKATSDINSPISGKVVEVNEALNSSPALVNSSPYKDGWIIKVEINDSGELNNLMDSEQYSKFCEEEDSKH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain