Glyma20g02303 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g02303): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g02303): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g02303

Feature Type:	gene_model
Chromosome:	Gm20
Start:	1946315
stop:	1949848
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g02303

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G75630	AT	Annotation by Michelle Graham. TAIR10: vacuolar H+-pumping ATPase 16 kDa proteolipid subunit 4 \| chr1:28400662-28402032 FORWARD LENGTH=166	SoyBase	E_val: 6.00E-24	ISS
GO:0015991	GO-bp	Annotation by Michelle Graham. GO Biological Process: ATP hydrolysis coupled proton transport	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0033177	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting two-sector ATPase complex, proton-transporting domain	SoyBase	N/A	ISS
GO:0033179	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting V-type ATPase, V0 domain	SoyBase	N/A	ISS
GO:0015078	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrogen ion transmembrane transporter activity	SoyBase	N/A	ISS
GO:0016887	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATPase activity	SoyBase	N/A	ISS
PTHR10263	Panther	VACUOLAR ATP SYNTHASE PROTEOLIPID SUBUNIT	JGI		ISS
PTHR10263:SF2	Panther	VACUOLAR ATP SYNTHASE PROTEOLIPID SUBUNIT 1, 2, 3, 4	JGI		ISS
UniRef100_D2JP66	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Vacuolar H+-ATPase 16kDa subunit c n=1 Tax=Iris lactea var. lactea RepID=D2JP66_9ASPA	SoyBase	E_val: 2.00E-21	ISS
UniRef100_UPI000233DA21	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233DA21 related cluster n=1 Tax=unknown RepID=UPI000233DA21	SoyBase	E_val: 3.00E-25	ISS

Expression Patterns of Glyma20g02303

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g02303 not represented in the dataset	Glyma20g02303 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g02303 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g018700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g02303

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g02303

Limit To All Plant Sequences

>Glyma20g02303.1   sequence type=CDS   gene model=Glyma20g02303   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTCAGTTGTGCTTTGGTGGTTTTTTTGGAGCAATGGTTTTGTTGGATTCAATTAAGCTACTGCAAATCGTAGACTTAGTTTTACATATAAACTCAGGTATGGGAGCTACCTATGGCACAACGAAGAGTGGCGTGGGCGTGGCTTCAATAGGTGTGATGAGATCGGAGTTGGTGATGAAGTCTATTGTCCCTGTTGTTATGGCGCAACTCTCCTCTGGTCTTGCTTGTGGGCTGGTTGGTCTTTCTGCTGGCATGGCTATTGGTATTGTTGGTAATGCTGGTGTTAGGATGGGCAGAAGAGAATCCAAACACGTCTATCATCACTCAAACTTGTGGTGTTGTGAGGACAAAGTACCAACCAACAAAGGATGGCCCAATCTAATTGTAACATACCTATGA

Predicted protein sequences of Glyma20g02303

Limit To All Plant Sequences

>Glyma20g02303.1   sequence type=predicted peptide   gene model=Glyma20g02303   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIQLCFGGFFGAMVLLDSIKLLQIVDLVLHINSGMGATYGTTKSGVGVASIGVMRSELVMKSIVPVVMAQLSSGLACGLVGLSAGMAIGIVGNAGVRMGRRESKHVYHHSNLWCCEDKVPTNKGWPNLIVTYL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain