Glyma20g02210 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g02210

Feature Type:	gene_model
Chromosome:	Gm20
Start:	1842110
stop:	1843372
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g02210

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G14930	AT	Annotation by Michelle Graham. TAIR10: Polyketide cyclase/dehydrase and lipid transport superfamily protein \| chr1:5152465-5153035 REVERSE LENGTH=155	SoyBase	E_val: 2.00E-24	ISS
GO:0006952	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response	SoyBase	N/A	ISS
GO:0005575	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cellular component	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF00407	PFAM	Pathogenesis-related protein Bet v I family	JGI		ISS
UniRef100_Q9SMF5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Major latex protein homolog n=8 Tax=Glycine max RepID=Q9SMF5_SOYBN	SoyBase	E_val: 4.00E-105	ISS
UniRef100_Q9SMF5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Major latex protein homolog n=8 Tax=Glycine max RepID=Q9SMF5_SOYBN	SoyBase	E_val: 4.00E-105	ISS

Expression Patterns of Glyma20g02210

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g02210

Paralog	Evidence	Comments
Glyma07g34461	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g02210 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g017900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g02210

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g02210

Limit To All Plant Sequences

>Glyma20g02210.1   sequence type=CDS   gene model=Glyma20g02210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTCAACCCGACTCGTTGGTGGCTGAGATTGAGGTGAAAACCTCTGCTGATCACTTTTACGACACCTTGAAGGGTAAGAAACAGCATCGTATTCATGATGTTGCCCCTCATCATATCCATAAGGTGGAAGTTCATGAAGGTGAGTGGGATAAATCTGGCAATATCAAGGTGCTTACATTCGCTGATGGGGACACTGTTGAGACCTTAAAGGAGAGAGTTGATTTTGATGATGAAAACAAGAAGATAACCTACACCATATTGGAGGGTGTCATGTTGAAGTACTATAAGAGCTACAAGGTTATCGTTCATGTTTTACCAAAAGGTGATGAGCACAGCCTTGTGAAGTGGACTTTCTTGTATGAGAAGGTGGATCACACTGCCCCTGAGCCAACCAAGTACAAAGATTTGGTGGTTAAACTCACCAAGAACGTGGAGGCTCATCTTGTTGAGGCTCGTTAA

Predicted protein sequences of Glyma20g02210

Limit To All Plant Sequences

>Glyma20g02210.1   sequence type=predicted peptide   gene model=Glyma20g02210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSQPDSLVAEIEVKTSADHFYDTLKGKKQHRIHDVAPHHIHKVEVHEGEWDKSGNIKVLTFADGDTVETLKERVDFDDENKKITYTILEGVMLKYYKSYKVIVHVLPKGDEHSLVKWTFLYEKVDHTAPEPTKYKDLVVKLTKNVEAHLVEAR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain