Glyma20g02120 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g02120): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g02120): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g02120

Feature Type:	gene_model
Chromosome:	Gm20
Start:	1696263
stop:	1697992
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g02120

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G37410	AT	Annotation by Michelle Graham. TAIR10: translocase inner membrane subunit 17-2 \| chr2:15698119-15698850 REVERSE LENGTH=243	SoyBase	E_val: 2.00E-89	ISS
GO:0015031	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein transport	SoyBase	N/A	ISS
GO:0045039	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein import into mitochondrial inner membrane	SoyBase	N/A	ISS
GO:0048573	GO-bp	Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering	SoyBase	N/A	ISS
GO:0051604	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein maturation	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005741	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial outer membrane	SoyBase	N/A	ISS
GO:0005743	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane	SoyBase	N/A	ISS
GO:0005744	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane presequence translocase complex	SoyBase	N/A	ISS
GO:0015450	GO-mf	Annotation by Michelle Graham. GO Molecular Function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity	SoyBase	N/A	ISS
KOG1652	KOG	Mitochondrial import inner membrane translocase, subunit TIM17	JGI		ISS
PTHR10485	Panther	MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM17	JGI		ISS
PTHR10485:SF0	Panther	MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCASE SU	JGI		ISS
PF02466	PFAM	Tim17/Tim22/Tim23 family	JGI		ISS
UniRef100_B9RKH3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial import inner membrane translocase subunit tim17, putative n=1 Tax=Ricinus communis RepID=B9RKH3_RICCO	SoyBase	E_val: 1.00E-98	ISS
UniRef100_I1ND97	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1ND97_SOYBN	SoyBase	E_val: 3.00E-150	ISS

Expression Patterns of Glyma20g02120

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g02120 not represented in the dataset	Glyma20g02120 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g02120 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g017300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g02120

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g02120

Limit To All Plant Sequences

>Glyma20g02120.1   sequence type=CDS   gene model=Glyma20g02120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAACTCCAGAGACGTCAAGGGAACCATGTCCAGACCGCATCCTGGACGACATAGGCGGCGCGTTCGGCATGGGCGCGGTGGGTGGGTCCGCCTTCCACTTCCTCAAGGGCCTCTACAACGCACCAAGGGGCGCGCGTGTCGTCGCCGCGTCACAAGCGGTACGCCTCAACGCGCCGCGCGTGGGCGGAAGCTTCGCCGTGTGGGGCGGCCTCTTCTCCAGCTTCGACTGCACCATGGTCTACCTCCGCCAGAAGGAGGACCCCTGGAACTCCATCTTCGCCGGCGCCGCCACCGGCGGCTTCCTCTCCATGCGCCAGGGCCTCCCCGCCGCCGCCCGCTCCGCTGCGTTCGGCGGCGTCCTTCTCGCTCTCATCGAGGGCGCCGGCATCATGCTCAACAAGTTCCTCAGCGCGCAGCAGCCGATGCCGATGATTGTCGATGAGCCTCTTCCGCCTAACGGGCTACCGGGCCAGCCGGTTGCTTCGGCGCCGGACGCTGCCTCGCAATCGTCGTGGTTAGGTGGTTGGTTCGGCGATGGGAAGAAGGATGAGGCGGCGGCGGAGGCTACCGGAGGAAGCGAGACCAAGGTTTTAGAGAGCTTTGATGCGCCTCCTGTGCCCAATTTCGAGTACAAGTGA

Predicted protein sequences of Glyma20g02120

Limit To All Plant Sequences

>Glyma20g02120.1   sequence type=predicted peptide   gene model=Glyma20g02120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGTPETSREPCPDRILDDIGGAFGMGAVGGSAFHFLKGLYNAPRGARVVAASQAVRLNAPRVGGSFAVWGGLFSSFDCTMVYLRQKEDPWNSIFAGAATGGFLSMRQGLPAAARSAAFGGVLLALIEGAGIMLNKFLSAQQPMPMIVDEPLPPNGLPGQPVASAPDAASQSSWLGGWFGDGKKDEAAAEATGGSETKVLESFDAPPVPNFEYK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain