|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
ATCG00680 | AT | Annotation by Michelle Graham. TAIR10: photosystem II reaction center protein B | chrC:72371-73897 FORWARD LENGTH=508 | SoyBase | E_val: 4.00E-50 | ISS |
GO:0006091 | GO-bp | Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy | SoyBase | N/A | ISS |
GO:0006354 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation | SoyBase | N/A | ISS |
GO:0009767 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport chain | SoyBase | N/A | ISS |
GO:0010207 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosystem II assembly | SoyBase | N/A | ISS |
GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
GO:0019684 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0009521 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: photosystem | SoyBase | N/A | ISS |
GO:0009523 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: photosystem II | SoyBase | N/A | ISS |
GO:0009534 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid | SoyBase | N/A | ISS |
GO:0009535 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane | SoyBase | N/A | ISS |
GO:0009539 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: photosystem II reaction center | SoyBase | N/A | ISS |
GO:0009579 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: thylakoid | SoyBase | N/A | ISS |
GO:0010287 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule | SoyBase | N/A | ISS |
GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
GO:0016168 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: chlorophyll binding | SoyBase | N/A | ISS |
PF00421 | PFAM | Photosystem II protein | JGI | ISS | |
UniRef100_C5XLE8 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein Sb03g020131 (Fragment) n=1 Tax=Sorghum bicolor RepID=C5XLE8_SORBI | SoyBase | E_val: 4.00E-50 | ISS |
UniRef100_G7JQ99 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Photosystem II CP47 chlorophyll apoprotein n=1 Tax=Medicago truncatula RepID=G7JQ99_MEDTR | SoyBase | E_val: 5.00E-49 | ISS |
Glyma20g02071 not represented in the dataset |
Glyma20g02071 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma20g02071.1 sequence type=CDS gene model=Glyma20g02071 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high CCCCATTGGCTTCTAGGAATATGTATCAATTCGCGATGCTTTGACCCTGTTCTTGATCCAATGTGGAGACAGGGTATGTTCGTTATACCTTTCATGACTCATTTAGGAATAACCAATTTGTGGGGCGGTTGGAATATCACAGGAGGGACTATAATGAATCTGGGTATTTGGAGTTATGAAGGTGTGAACGGAGCATATATTGAGTTTTCGGGCTTGTTCTTTTTAGCGACTATTTGGAATTGGGTTTATTGGGATCTAGAAATCTTTTATGATGAATGTATTGGAAAAACTTCTTTGGATTTGCCCACATTTTTTGGAATTCATTTATTTCTTGCAGGGGTGACTTTATAA
>Glyma20g02071.1 sequence type=predicted peptide gene model=Glyma20g02071 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high PHWLLGICINSRCFDPVLDPMWRQGMFVIPFMTHLGITNLWGGWNITGGTIMNLGIWSYEGVNGAYIEFSGLFFLATIWNWVYWDLEIFYDECIGKTSLDLPTFFGIHLFLAGVTL*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||