|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G78340 | AT | Annotation by Michelle Graham. TAIR10: glutathione S-transferase TAU 22 | chr1:29473046-29473797 REVERSE LENGTH=218 | SoyBase | E_val: 7.00E-14 | ISS |
| GO:0009407 | GO-bp | Annotation by Michelle Graham. GO Biological Process: toxin catabolic process | SoyBase | N/A | ISS |
| GO:0010583 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0004364 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: glutathione transferase activity | SoyBase | N/A | ISS |
| PF00043 | PFAM | Glutathione S-transferase, C-terminal domain | JGI | ISS | |
| UniRef100_C6T372 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T372_SOYBN | SoyBase | E_val: 1.00E-17 | ISS |
| UniRef100_Q9FQE8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Glutathione S-transferase n=1 Tax=Glycine max RepID=Q9FQE8_SOYBN | SoyBase | E_val: 2.00E-17 | ISS |
|
Glyma20g01910 not represented in the dataset |
Glyma20g01910 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma20g01910.1 sequence type=CDS gene model=Glyma20g01910 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATTTGGACATCAAAGGGAGAAGAAAAAGAAGCTGCCAAGAAGGAGTTCATAGAGGCCCTTAAATTGTTGGAGGAACAGCTGGGAGATAAGACTTATTTTGGAGGAGACAATATTGGC
>Glyma20g01910.1 sequence type=predicted peptide gene model=Glyma20g01910 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high IWTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGGDNIG
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||