Glyma20g01865 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g01865): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g01865): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g01865

Feature Type:	gene_model
Chromosome:	Gm20
Start:	1407571
stop:	1408851
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g01865

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G54470	AT	Annotation by Michelle Graham. TAIR10: uridine 5'-monophosphate synthase / UMP synthase (PYRE-F) (UMPS) \| chr3:20168285-20170245 REVERSE LENGTH=476	SoyBase	E_val: 9.00E-60	ISS
GO:0006207	GO-bp	Annotation by Michelle Graham. GO Biological Process: 'de novo' pyrimidine nucleobase biosynthetic process	SoyBase	N/A	ISS
GO:0006221	GO-bp	Annotation by Michelle Graham. GO Biological Process: pyrimidine nucleotide biosynthetic process	SoyBase	N/A	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0009116	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleoside metabolic process	SoyBase	N/A	ISS
GO:0009220	GO-bp	Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process	SoyBase	N/A	ISS
GO:0016036	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation	SoyBase	N/A	ISS
GO:0044205	GO-bp	Annotation by Michelle Graham. GO Biological Process: 'de novo' UMP biosynthetic process	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004588	GO-mf	Annotation by Michelle Graham. GO Molecular Function: orotate phosphoribosyltransferase activity	SoyBase	N/A	ISS
GO:0004590	GO-mf	Annotation by Michelle Graham. GO Molecular Function: orotidine-5'-phosphate decarboxylase activity	SoyBase	N/A	ISS
PTHR19278	Panther	OROTIDINE 5-PHOSPHATE DECARBOXYLASE-RELATED	JGI		ISS
PTHR19278:SF21	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00215	PFAM	Orotidine 5'-phosphate decarboxylase / HUMPS family	JGI		ISS
UniRef100_I1LLC6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LLC6_SOYBN	SoyBase	E_val: 2.00E-69	ISS
UniRef100_I1MR50	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Orotidine 5'-phosphate decarboxylase n=1 Tax=Glycine max RepID=I1MR50_SOYBN	SoyBase	E_val: 2.00E-65	ISS

Expression Patterns of Glyma20g01865

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g01865 not represented in the dataset	Glyma20g01865 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g01865 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g015500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g01865

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g01865

Limit To All Plant Sequences

>Glyma20g01865.1   sequence type=CDS   gene model=Glyma20g01865   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGACAGAGGTTGTTTGAGATAATGGCTGAGAAGGAGAGTAATATGTGTTTGGCTGCTGATGTTGGAACTGGAGCTGAATTGCTTGAAATTGCTGAGAAGGTTGGACCTGAGATATGCTTGCTGAAGACTCATGTAGATATTTTTCCAGATTTTACTGCTGATTTTGGCTCTAATCTTCTCTCAATTGCAGAAAAAGATAACTTCTTAATCTTTGAGGATCGTAAATTTGCTGATATTGGCAACACAATGACCATGCAATATGAAGGAGGGGTCTTTCGTATATTGGATTGGGCTCATATAGTAAATGTTCACATAATCTCAGGTCCTGGAATTGTAAATAAATTGTCATCATATTTGCTGATGAATCCTGTCGAGAACTAA

Predicted protein sequences of Glyma20g01865

Limit To All Plant Sequences

>Glyma20g01865.1   sequence type=predicted peptide   gene model=Glyma20g01865   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGQRLFEIMAEKESNMCLAADVGTGAELLEIAEKVGPEICLLKTHVDIFPDFTADFGSNLLSIAEKDNFLIFEDRKFADIGNTMTMQYEGGVFRILDWAHIVNVHIISGPGIVNKLSSYLLMNPVEN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain