Glyma20g01540 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g01540): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g01540): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g01540

Feature Type:	gene_model
Chromosome:	Gm20
Start:	1059777
stop:	1061618
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g01540

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G25570	AT	Annotation by Michelle Graham. TAIR10: Cytochrome b561/ferric reductase transmembrane protein family \| chr4:13053887-13055518 REVERSE LENGTH=239	SoyBase	E_val: 5.00E-57	ISS
GO:0000271	GO-bp	Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process	SoyBase	N/A	ISS
GO:0009825	GO-bp	Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth	SoyBase	N/A	ISS
GO:0009932	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell tip growth	SoyBase	N/A	ISS
GO:0010817	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels	SoyBase	N/A	ISS
GO:0019344	GO-bp	Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process	SoyBase	N/A	ISS
GO:0043481	GO-bp	Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light	SoyBase	N/A	ISS
GO:0048767	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair elongation	SoyBase	N/A	ISS
GO:0071555	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell wall organization	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0008805	GO-mf	Annotation by Michelle Graham. GO Molecular Function: carbon-monoxide oxygenase activity	SoyBase	N/A	ISS
KOG1619	KOG	Cytochrome b	JGI		ISS
PTHR10106	Panther	CYTOCHROME B561	JGI		ISS
PTHR10106:SF0	Panther	CYTOCHROME B561-RELATED	JGI		ISS
PF03188	PFAM	Eukaryotic cytochrome b561	JGI		ISS
UniRef100_B9SNH6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome B561, putative n=1 Tax=Ricinus communis RepID=B9SNH6_RICCO	SoyBase	E_val: 2.00E-82	ISS
UniRef100_I1ND59	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1ND59_SOYBN	SoyBase	E_val: 2.00E-152	ISS

Expression Patterns of Glyma20g01540

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g01540 not represented in the dataset	Glyma20g01540 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g01540 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g012500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g01540

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g01540

Limit To All Plant Sequences

>Glyma20g01540.1   sequence type=CDS   gene model=Glyma20g01540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCGTGGCTTCCAAGTTCGAGCTACTTCAGTTACCATATTTGCTCATTTGTTGTTCATAGCAATAGCAACCCTTGTGTTAGTTTGGTTGCTACACTTTCGAGAAGGTGTGGCCTTCTTCAGCTCTTCCAACCCAGTCAAGATTTTCAACCTGCATCCTCTTCTAATGGTAATTGGATTTATTTTAGTTGGTGGAGAAGCAATCATGATATACAAGTCGGTGCCTGAAAAAAGGAGGTCAGTGAAGGTGGTTCACCTCCTATTGCATCTGATAGCTTTAGTGGCTGGAATTATAGGGATTATTGCAGTTTTCAAATCTAAGAAAGAGGCAGGTCTTGCTGATATGTATACATTACACTCTTGGCTAGGCATGTCAGCAATCTCACTATTTGGCTTACAGTATATATTTGGGTTCTTTGCTTATTTCTTCCCCGGTGCAGAAATGTCTGCTAGAGCTTCCCTTTTGCCATGGCACAGGTTTATGGGCATGGCCATATTCCTCCTTGCAGTTGCCACAGCTGAGACGGGTTTGGTTGAATATTTCCAGTTTTTACAGCTTTTCCGCACTCAAGAGGCACTAATTATCAACTCCACTGGTCTCTTACTCTTCCTCTTTGCCGTCTTTGTTACCCTCTCTGTCATTCTCCAAAGAAATTACTGA

Predicted protein sequences of Glyma20g01540

Limit To All Plant Sequences

>Glyma20g01540.1   sequence type=predicted peptide   gene model=Glyma20g01540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MARGFQVRATSVTIFAHLLFIAIATLVLVWLLHFREGVAFFSSSNPVKIFNLHPLLMVIGFILVGGEAIMIYKSVPEKRRSVKVVHLLLHLIALVAGIIGIIAVFKSKKEAGLADMYTLHSWLGMSAISLFGLQYIFGFFAYFFPGAEMSARASLLPWHRFMGMAIFLLAVATAETGLVEYFQFLQLFRTQEALIINSTGLLLFLFAVFVTLSVILQRNY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain