SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g01280): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g01280): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g01280

Feature Type:gene_model
Chromosome:Gm20
Start:865972
stop:868045
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g01280
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G33945AT Annotation by Michelle Graham. TAIR10: ARM repeat superfamily protein | chr4:16268119-16270514 FORWARD LENGTH=464 SoyBaseE_val: 2.00E-49ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PTHR22895Panther UNCHARACTERIZED JGI ISS
UniRef100_B9S778UniRef Annotation by Michelle Graham. Most informative UniRef hit: Armadillo repeat-containing protein, putative n=1 Tax=Ricinus communis RepID=B9S778_RICCO SoyBaseE_val: 1.00E-52ISS
UniRef100_I1KL25UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KL25_SOYBN SoyBaseE_val: 5.00E-72ISS

Expression Patterns of Glyma20g01280
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g01280 not represented in the dataset
Glyma20g01280 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g01280
ParalogEvidenceComments
Glyma07g29440 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g01280 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g009900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g01280
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g01280
>Glyma20g01280.1   sequence type=CDS   gene model=Glyma20g01280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TCGCCATCTTTTGAATTGTGCGTACATCATGACTTAAAAATGTCCAATATGTTCTATCTCCAGGTAAGCCCTTGTGGACCTGACTTGATTTCAGCATGCATCACTTTGAGGGCCATTGCCGTAAATGATGAAATATGTAAATCCATTGCTGAGAAAGGTGGTATTGATGCAATACTCAGACGTATAGATGACAGTGGTGAACAAGGCAACAAAGCTGTGGCCAAAGTTTGTTGCTCATTACTTTCAAAGTTAGCAGGAAGTGACGCAAACAAGAGTACAATTGTTGGGAAAGGAGGTATGGATAAGCTAATTAAACTTTCAGCCAGATTTGCTGATGACCCTTCTGTTTTGCAAGAGATTATGTCTATTATTTTGGTGACCTCGCTATTCAAGCAATGGAGAAATCCAGAGAACAGGCAAGCAAGTGTGCTCATTATGGTTACCCTTCTTGCACATTTTCTATTGGACAGAACTATCTTGCTTAATAATGGAATTGAGAAATACATAAGGAAAGCAAAGCAAACACATAGCAACTGTACAGATGGGTCGAGGGATTTGGAGCTTGATAATTTTGACCTCTATTGTTTTACAATGTAA
Predicted protein sequences of Glyma20g01280
>Glyma20g01280.1   sequence type=predicted peptide   gene model=Glyma20g01280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SPSFELCVHHDLKMSNMFYLQVSPCGPDLISACITLRAIAVNDEICKSIAEKGGIDAILRRIDDSGEQGNKAVAKVCCSLLSKLAGSDANKSTIVGKGGMDKLIKLSARFADDPSVLQEIMSIILVTSLFKQWRNPENRQASVLIMVTLLAHFLLDRTILLNNGIEKYIRKAKQTHSNCTDGSRDLELDNFDLYCFTM*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo