Glyma19g45221 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g45221): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g45221): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g45221

Feature Type:	gene_model
Chromosome:	Gm19
Start:	50428683
stop:	50429134
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g45221

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G40990	AT	Annotation by Michelle Graham. TAIR10: GDSL lipase 1 \| chr5:16418920-16420400 FORWARD LENGTH=374	SoyBase	E_val: 6.00E-22	ISS
GO:0006629	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid metabolic process	SoyBase	N/A	ISS
GO:0009620	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to fungus	SoyBase	N/A	ISS
GO:0009627	GO-bp	Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance	SoyBase	N/A	ISS
GO:0009751	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus	SoyBase	N/A	ISS
GO:0009817	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to fungus, incompatible interaction	SoyBase	N/A	ISS
GO:0009866	GO-bp	Annotation by Michelle Graham. GO Biological Process: induced systemic resistance, ethylene mediated signaling pathway	SoyBase	N/A	ISS
GO:0009871	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid and ethylene-dependent systemic resistance, ethylene mediated signaling pathway	SoyBase	N/A	ISS
GO:0042742	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium	SoyBase	N/A	ISS
GO:0050832	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to fungus	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005615	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular space	SoyBase	N/A	ISS
GO:0016298	GO-mf	Annotation by Michelle Graham. GO Molecular Function: lipase activity	SoyBase	N/A	ISS
GO:0016788	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds	SoyBase	N/A	ISS
PTHR22835	Panther	ZINC FINGER FYVE DOMAIN CONTAINING PROTEIN	JGI		ISS
PTHR22835:SF39	Panther	LATERAL SIGNALING TARGET PROTEIN 2	JGI		ISS
PF00657	PFAM	GDSL-like Lipase/Acylhydrolase	JGI		ISS
UniRef100_G7KQ44	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: GDSL esterase/lipase n=1 Tax=Medicago truncatula RepID=G7KQ44_MEDTR	SoyBase	E_val: 1.00E-39	ISS
UniRef100_I1JS77	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JS77_SOYBN	SoyBase	E_val: 5.00E-49	ISS

Expression Patterns of Glyma19g45221

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g45221 not represented in the dataset	Glyma19g45221 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g45221 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g262800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g45221

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g45221

Limit To All Plant Sequences

>Glyma19g45221.1   sequence type=CDS   gene model=Glyma19g45221   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAAGTCCGAAATCCAGTTTCTGCCTCCTGGTTCTTTTTGTAAGCCCAACTTGCTGCCTTGGTGAAATATGCCAGCCGAAAAAACCCGCCGCATTATTTGTATTTGGAGATTCAATATTTGATGTTGGAAACAATAATTACATCAATACTACTGCTGATATTCATGCAAATTTCTTTCCGTATGGGGAAACCTTCTTCAAGTATCCAACTGGTAGATTTTCTGATGGTCGCGTGATTCCAGATTTCATAGGAGCTGGGGCATTGGTTGAAACCCATCAAGGACTGGTCTGTTGTATGTTATTGTTAACTAATTAA

Predicted protein sequences of Glyma19g45221

Limit To All Plant Sequences

>Glyma19g45221.1   sequence type=predicted peptide   gene model=Glyma19g45221   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASPKSSFCLLVLFVSPTCCLGEICQPKKPAALFVFGDSIFDVGNNNYINTTADIHANFFPYGETFFKYPTGRFSDGRVIPDFIGAGALVETHQGLVCCMLLLTN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain