SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g45221): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g45221): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g45221

Feature Type:gene_model
Chromosome:Gm19
Start:50428683
stop:50429134
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G40990AT Annotation by Michelle Graham. TAIR10: GDSL lipase 1 | chr5:16418920-16420400 FORWARD LENGTH=374 SoyBaseE_val: 6.00E-22ISS
GO:0006629GO-bp Annotation by Michelle Graham. GO Biological Process: lipid metabolic process SoyBaseN/AISS
GO:0009620GO-bp Annotation by Michelle Graham. GO Biological Process: response to fungus SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009751GO-bp Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus SoyBaseN/AISS
GO:0009817GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus, incompatible interaction SoyBaseN/AISS
GO:0009866GO-bp Annotation by Michelle Graham. GO Biological Process: induced systemic resistance, ethylene mediated signaling pathway SoyBaseN/AISS
GO:0009871GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid and ethylene-dependent systemic resistance, ethylene mediated signaling pathway SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005615GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular space SoyBaseN/AISS
GO:0016298GO-mf Annotation by Michelle Graham. GO Molecular Function: lipase activity SoyBaseN/AISS
GO:0016788GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds SoyBaseN/AISS
PTHR22835Panther ZINC FINGER FYVE DOMAIN CONTAINING PROTEIN JGI ISS
PTHR22835:SF39Panther LATERAL SIGNALING TARGET PROTEIN 2 JGI ISS
PF00657PFAM GDSL-like Lipase/Acylhydrolase JGI ISS
UniRef100_G7KQ44UniRef Annotation by Michelle Graham. Most informative UniRef hit: GDSL esterase/lipase n=1 Tax=Medicago truncatula RepID=G7KQ44_MEDTR SoyBaseE_val: 1.00E-39ISS
UniRef100_I1JS77UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JS77_SOYBN SoyBaseE_val: 5.00E-49ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g45221 not represented in the dataset

Glyma19g45221 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g262800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g45221.1   sequence type=CDS   gene model=Glyma19g45221   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAAGTCCGAAATCCAGTTTCTGCCTCCTGGTTCTTTTTGTAAGCCCAACTTGCTGCCTTGGTGAAATATGCCAGCCGAAAAAACCCGCCGCATTATTTGTATTTGGAGATTCAATATTTGATGTTGGAAACAATAATTACATCAATACTACTGCTGATATTCATGCAAATTTCTTTCCGTATGGGGAAACCTTCTTCAAGTATCCAACTGGTAGATTTTCTGATGGTCGCGTGATTCCAGATTTCATAGGAGCTGGGGCATTGGTTGAAACCCATCAAGGACTGGTCTGTTGTATGTTATTGTTAACTAATTAA

>Glyma19g45221.1   sequence type=predicted peptide   gene model=Glyma19g45221   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASPKSSFCLLVLFVSPTCCLGEICQPKKPAALFVFGDSIFDVGNNNYINTTADIHANFFPYGETFFKYPTGRFSDGRVIPDFIGAGALVETHQGLVCCMLLLTN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo