Glyma19g45101 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g45101): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g45101): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g45101

Feature Type:	gene_model
Chromosome:	Gm19
Start:	50351840
stop:	50352936
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g45101

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G28450	AT	Annotation by Michelle Graham. TAIR10: Chlorophyll A-B binding family protein \| chr5:10372978-10374190 REVERSE LENGTH=173	SoyBase	E_val: 2.00E-10	ISS
GO:0009765	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis, light harvesting	SoyBase	N/A	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0030076	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: light-harvesting complex	SoyBase	N/A	ISS
GO:0016168	GO-mf	Annotation by Michelle Graham. GO Molecular Function: chlorophyll binding	SoyBase	N/A	ISS
UniRef100_F4K8I1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Light-harvesting complex I chlorophyll a/b binding protein 2 n=1 Tax=Arabidopsis thaliana RepID=F4K8I1_ARATH	SoyBase	E_val: 8.00E-08	ISS
UniRef100_F4K8I1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Light-harvesting complex I chlorophyll a/b binding protein 2 n=1 Tax=Arabidopsis thaliana RepID=F4K8I1_ARATH	SoyBase	E_val: 8.00E-08	ISS

Expression Patterns of Glyma19g45101

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g45101 not represented in the dataset	Glyma19g45101 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g45101 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g261400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g45101

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g45101

Limit To All Plant Sequences

>Glyma19g45101.1   sequence type=CDS   gene model=Glyma19g45101   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCACTAGAGTGTGTGCAGTTGCTGAGCCTGACAGGCCTCTCTGGTCCTCCATGGCTGGAGAGCTGGAATACTTCACAGACACCACTAGCCTCTTTTTCATAGGTGCATGGTTCCAGTACATTTACACTGCCACCTGTCCTATTGACAACCTCTTTGCTCACCTTGCAGATCCTTCCTATACTAACCATTTCAATTAA

Predicted protein sequences of Glyma19g45101

Limit To All Plant Sequences

>Glyma19g45101.1   sequence type=predicted peptide   gene model=Glyma19g45101   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGTRVCAVAEPDRPLWSSMAGELEYFTDTTSLFFIGAWFQYIYTATCPIDNLFAHLADPSYTNHFN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain