|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G28450 | AT | Annotation by Michelle Graham. TAIR10: Chlorophyll A-B binding family protein | chr5:10372978-10374190 REVERSE LENGTH=173 | SoyBase | E_val: 2.00E-10 | ISS |
| GO:0009765 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis, light harvesting | SoyBase | N/A | ISS |
| GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0030076 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: light-harvesting complex | SoyBase | N/A | ISS |
| GO:0016168 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: chlorophyll binding | SoyBase | N/A | ISS |
| UniRef100_F4K8I1 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Light-harvesting complex I chlorophyll a/b binding protein 2 n=1 Tax=Arabidopsis thaliana RepID=F4K8I1_ARATH | SoyBase | E_val: 8.00E-08 | ISS |
| UniRef100_F4K8I1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Light-harvesting complex I chlorophyll a/b binding protein 2 n=1 Tax=Arabidopsis thaliana RepID=F4K8I1_ARATH | SoyBase | E_val: 8.00E-08 | ISS |
|
Glyma19g45101 not represented in the dataset |
Glyma19g45101 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.19g261400 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g45101.1 sequence type=CDS gene model=Glyma19g45101 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGGCACTAGAGTGTGTGCAGTTGCTGAGCCTGACAGGCCTCTCTGGTCCTCCATGGCTGGAGAGCTGGAATACTTCACAGACACCACTAGCCTCTTTTTCATAGGTGCATGGTTCCAGTACATTTACACTGCCACCTGTCCTATTGACAACCTCTTTGCTCACCTTGCAGATCCTTCCTATACTAACCATTTCAATTAA
>Glyma19g45101.1 sequence type=predicted peptide gene model=Glyma19g45101 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MGTRVCAVAEPDRPLWSSMAGELEYFTDTTSLFFIGAWFQYIYTATCPIDNLFAHLADPSYTNHFN*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||