SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 156 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g44440): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g44440): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g44440

Feature Type:gene_model
Chromosome:Gm19
Start:49873952
stop:49877108
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G60750AT Annotation by Michelle Graham. TAIR10: NAD(P)-linked oxidoreductase superfamily protein | chr1:22362293-22363854 REVERSE LENGTH=330 SoyBaseE_val: 6.00E-46ISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
PTHR11732Panther ALDO/KETO REDUCTASE JGI ISS
PTHR11732:SF12Panther OXIDOREDUCTASE JGI ISS
PF00248PFAM Aldo/keto reductase family JGI ISS
UniRef100_G7L1V7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auxin-induced protein PCNT115 n=1 Tax=Medicago truncatula RepID=G7L1V7_MEDTR SoyBaseE_val: 2.00E-58ISS
UniRef100_UPI000233ED0AUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233ED0A related cluster n=1 Tax=unknown RepID=UPI000233ED0A SoyBaseE_val: 1.00E-72ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g44440 not represented in the dataset

Glyma19g44440 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g255400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g44440.1   sequence type=CDS   gene model=Glyma19g44440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTAAATGGTAATACTGTGATAGTGAATGGTTCCCCTGAATATGTTCGGTCCTGTTGCGAGGGTAGCCTCCAACGCCTTGGTGCCAGCTACATTGATCTCTATTATCAGCACCCTGTTGACACCACTGTACCCATTGAAGACACTATGGGAGTGCTTAAAAAGCTGGTCCAAGAGGGAAAAATAAGGTACATTGGATTGTCGGAAGCTAGCCTTGTCACAATTAGAAGGGCACATGCTGTTCATCCCATTACTGCTGTGCAAATGGAGTGCTCCCTTTGGACTCGTGAAATTGAGCAAGATATTGTTCCACTTTGCAGGTTAAAGCTCTACCTTACAAGCTTACAAGCAGAATTTGTGGATTATCCGGTCATAATTTCATAA

>Glyma19g44440.1   sequence type=predicted peptide   gene model=Glyma19g44440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVNGNTVIVNGSPEYVRSCCEGSLQRLGASYIDLYYQHPVDTTVPIEDTMGVLKKLVQEGKIRYIGLSEASLVTIRRAHAVHPITAVQMECSLWTREIEQDIVPLCRLKLYLTSLQAEFVDYPVIIS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo