Glyma19g44101 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g44101): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g44101): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g44101

Feature Type:	gene_model
Chromosome:	Gm19
Start:	49617662
stop:	49622701
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g44101

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G26530	AT	Annotation by Michelle Graham. TAIR10: PIN domain-like family protein \| chr1:9165890-9167298 FORWARD LENGTH=178	SoyBase	E_val: 5.00E-45	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009855	GO-bp	Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry	SoyBase	N/A	ISS
GO:0009944	GO-bp	Annotation by Michelle Graham. GO Biological Process: polarity specification of adaxial/abaxial axis	SoyBase	N/A	ISS
GO:0010014	GO-bp	Annotation by Michelle Graham. GO Biological Process: meristem initiation	SoyBase	N/A	ISS
GO:0010075	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PTHR12416	Panther	UNCHARACTERIZED	JGI		ISS
PF04900	PFAM	Fcf1	JGI		ISS
UniRef100_B4FS24	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Nucleolar protein involved in pre-mRNA processing n=1 Tax=Zea mays RepID=B4FS24_MAIZE	SoyBase	E_val: 1.00E-46	ISS
UniRef100_I3T9S6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Lotus japonicus RepID=I3T9S6_LOTJA	SoyBase	E_val: 6.00E-49	ISS

Expression Patterns of Glyma19g44101

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g44101 not represented in the dataset	Glyma19g44101 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g44101

Paralog	Evidence	Comments
Glyma03g41497	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g44101 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma19g44101

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g44101

Limit To All Plant Sequences

>Glyma19g44101.1   sequence type=CDS   gene model=Glyma19g44101   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTAAAGCTAAAAAAGGACCCAAATTTGCGGTTATGAAGAAAGTTGTCACTTCCAAAGCAATCAAAAAGATTGCAAAGGATCCTCGATTTGAGAGAATACTCTGTACTCATAAAGGGACGTATGCTGATGATTGTCTTGTTGAGAGAGTTACTCAGCATAAGTGCTACATTGTTGCAACATGTGATCGGGACTTGAAGAGGAGGATCCGGAAGATTCCTGGTGTGCCAATTATGTACATCACCAAACACAAGTACTCAATTGAGCGATTGCCTGAAGCAACAATTGGTGGAGCACCAAGAATTTGA

Predicted protein sequences of Glyma19g44101

Limit To All Plant Sequences

>Glyma19g44101.1   sequence type=predicted peptide   gene model=Glyma19g44101   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGKAKKGPKFAVMKKVVTSKAIKKIAKDPRFERILCTHKGTYADDCLVERVTQHKCYIVATCDRDLKRRIRKIPGVPIMYITKHKYSIERLPEATIGGAPRI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain