SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g43890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g43890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g43890

Feature Type:gene_model
Chromosome:Gm19
Start:49433086
stop:49433786
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g43890
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G04300AT Annotation by Michelle Graham. TAIR10: RmlC-like cupins superfamily protein | chr3:1140318-1140723 FORWARD LENGTH=96 SoyBaseE_val: 5.00E-31ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF05899PFAM Protein of unknown function (DUF861) JGI ISS
UniRef100_B6U0I3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Enzyme of the cupin superfamily n=1 Tax=Zea mays RepID=B6U0I3_MAIZE SoyBaseE_val: 6.00E-27ISS
UniRef100_I1NCE8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NCE8_SOYBN SoyBaseE_val: 1.00E-60ISS

Expression Patterns of Glyma19g43890
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g43890 not represented in the dataset
Glyma19g43890 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g43890 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g249700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g43890
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g43890
>Glyma19g43890.2   sequence type=CDS   gene model=Glyma19g43890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACGCCAAATAAACTTTATTTTCATCTATCTCCAGACCTAACTACAGTTTTCTTCCATTTAACTCCAGAGCTAACAATGTCGGTTGAAAGCAAACCTACAGAGCTAAGGTTATTAGAGTTGGGTGTTATTTCGTGGACAAAATGGGGAAGAGCTCCAGGACAGTACGAGTCACACACAGAGGCACAAGAGACATATTTTTTGTTGAGAGGGAGAGTGAAGTTTATCCCGAAAGACTCAACATATGACCCTATAGAATTTGGTGCTGGCGATCTTGTTACCATACCAAAAGGACTCACATGCACATGGGACATCTCTGTTGCAGTCGACGCACATTACAAGTTCCAGCCCTAA
Predicted protein sequences of Glyma19g43890
>Glyma19g43890.2   sequence type=predicted peptide   gene model=Glyma19g43890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTPNKLYFHLSPDLTTVFFHLTPELTMSVESKPTELRLLELGVISWTKWGRAPGQYESHTEAQETYFLLRGRVKFIPKDSTYDPIEFGAGDLVTIPKGLTCTWDISVAVDAHYKFQP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo