Glyma19g43890 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g43890

Feature Type:	gene_model
Chromosome:	Gm19
Start:	49433086
stop:	49433786
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g43890

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G04300	AT	Annotation by Michelle Graham. TAIR10: RmlC-like cupins superfamily protein \| chr3:1140318-1140723 FORWARD LENGTH=96	SoyBase	E_val: 5.00E-31	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF05899	PFAM	Protein of unknown function (DUF861)	JGI		ISS
UniRef100_B6U0I3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Enzyme of the cupin superfamily n=1 Tax=Zea mays RepID=B6U0I3_MAIZE	SoyBase	E_val: 6.00E-27	ISS
UniRef100_I1NCE8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NCE8_SOYBN	SoyBase	E_val: 1.00E-60	ISS

Expression Patterns of Glyma19g43890

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g43890 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g249700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g43890

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g43890

Limit To All Plant Sequences

>Glyma19g43890.2   sequence type=CDS   gene model=Glyma19g43890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACGCCAAATAAACTTTATTTTCATCTATCTCCAGACCTAACTACAGTTTTCTTCCATTTAACTCCAGAGCTAACAATGTCGGTTGAAAGCAAACCTACAGAGCTAAGGTTATTAGAGTTGGGTGTTATTTCGTGGACAAAATGGGGAAGAGCTCCAGGACAGTACGAGTCACACACAGAGGCACAAGAGACATATTTTTTGTTGAGAGGGAGAGTGAAGTTTATCCCGAAAGACTCAACATATGACCCTATAGAATTTGGTGCTGGCGATCTTGTTACCATACCAAAAGGACTCACATGCACATGGGACATCTCTGTTGCAGTCGACGCACATTACAAGTTCCAGCCCTAA

Predicted protein sequences of Glyma19g43890

Limit To All Plant Sequences

>Glyma19g43890.2   sequence type=predicted peptide   gene model=Glyma19g43890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTPNKLYFHLSPDLTTVFFHLTPELTMSVESKPTELRLLELGVISWTKWGRAPGQYESHTEAQETYFLLRGRVKFIPKDSTYDPIEFGAGDLVTIPKGLTCTWDISVAVDAHYKFQP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain