Glyma19g43830 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g43830): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g43830): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g43830

Feature Type:	gene_model
Chromosome:	Gm19
Start:	49391892
stop:	49393645
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g43830

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G56070	AT	Annotation by Michelle Graham. TAIR10: rotamase cyclophilin 2 \| chr3:20806987-20807517 REVERSE LENGTH=176	SoyBase	E_val: 6.00E-103	ISS
GO:0001510	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA methylation	SoyBase	N/A	ISS
GO:0006364	GO-bp	Annotation by Michelle Graham. GO Biological Process: rRNA processing	SoyBase	N/A	ISS
GO:0006457	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein folding	SoyBase	N/A	ISS
GO:0007165	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0003755	GO-mf	Annotation by Michelle Graham. GO Molecular Function: peptidyl-prolyl cis-trans isomerase activity	SoyBase	N/A	ISS
GO:0016018	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cyclosporin A binding	SoyBase	N/A	ISS
KOG0865	KOG	Cyclophilin type peptidyl-prolyl cis-trans isomerase	JGI		ISS
PTHR11071	Panther	CYCLOPHILIN	JGI		ISS
PTHR11071:SF159	Panther		JGI		ISS
PF00160	PFAM	Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD	JGI		ISS
UniRef100_C6SYQ9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Peptidyl-prolyl cis-trans isomerase n=1 Tax=Glycine max RepID=C6SYQ9_SOYBN	SoyBase	E_val: 9.00E-125	ISS
UniRef100_C6SYQ9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Peptidyl-prolyl cis-trans isomerase n=1 Tax=Glycine max RepID=C6SYQ9_SOYBN	SoyBase	E_val: 9.00E-125	ISS

Expression Patterns of Glyma19g43830

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g43830 not represented in the dataset	Glyma19g43830 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g43830

Paralog	Evidence	Comments
Glyma03g41210	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g43830 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g249000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g43830

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g43830

Limit To All Plant Sequences

>Glyma19g43830.1   sequence type=CDS   gene model=Glyma19g43830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAAAGAATCCAAAAGTTTTCTTTGATATTCTAATTGGAAAGATGAAAGCTGGACGAGTAGTGATGGAGTTGTTTGCCGATGCAACCCCAAAAACAGCTGAAAACTTCAGGGCTCTCTGCACTGGGGAAAAGGGGATTGGACGATCTGGGAAACCTTTACACTACAAAGGTTCTGTATTTCATCGTATTATTCCAGAATTTATGTGTCAGGGAGGAGATTTCACAAGAGGGAATGGGACCGGGGGTGAGTCAATCTACGGTTCCAAATTTGAAGATGAGAATTTCAATTTGAGGCATACCGGTCCTGGTATTCTCTCCATGGCAAATGCTGGAGCTCATACTAATGGTTCTCAGTTCTTCATATGTACTACAAAGACACCATGGCTTGATGGGAAACATGTTGTGTTTGGAAAAGTTGTTGATGGATACAGCGTTGTGCAGGAGATGGAGAAAGTGGGTTCAGGAAGTGGCAGGACATCTGAACCGGTAGTAATAGAAGATTGTGGCCAGATTGTAGAGAAGTGA

Predicted protein sequences of Glyma19g43830

Limit To All Plant Sequences

>Glyma19g43830.1   sequence type=predicted peptide   gene model=Glyma19g43830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSKNPKVFFDILIGKMKAGRVVMELFADATPKTAENFRALCTGEKGIGRSGKPLHYKGSVFHRIIPEFMCQGGDFTRGNGTGGESIYGSKFEDENFNLRHTGPGILSMANAGAHTNGSQFFICTTKTPWLDGKHVVFGKVVDGYSVVQEMEKVGSGSGRTSEPVVIEDCGQIVEK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain