SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g43750

Feature Type:gene_model
Chromosome:Gm19
Start:49301272
stop:49306472
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g43750
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G08640AT Annotation by Michelle Graham. TAIR10: Chloroplast J-like domain 1 | chr1:2748714-2751209 REVERSE LENGTH=294 SoyBaseE_val: 4.00E-127ISS
GO:0006631GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid metabolic process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0031969GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast membrane SoyBaseN/AISS
PF11833PFAM Protein of unknown function (DUF3353) JGI ISS
UniRef100_I1NCD3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1NCD3_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q93WG3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Chloroplast J-like domain 1-containing protein n=1 Tax=Arabidopsis thaliana RepID=Q93WG3_ARATH SoyBaseE_val: 2.00E-124ISS

Expression Patterns of Glyma19g43750
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g43750
ParalogEvidenceComments
Glyma03g41110 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g43750 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g248200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g43750
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g43750
>Glyma19g43750.1   sequence type=CDS   gene model=Glyma19g43750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCTGGGAATCTCAAACATACTGCACTGCCCCAAATTGAGTTTCTCCCACAACAATTTTCGCCCAAAAGTTTCAACCTCTCTCAGCCTCAGGTTTCCCCAGACAGCAGCACGGAGTGATAGAAAGATCATCTGTGCTGCTGCATCTGCGGCTGGAAGCTCTAATCCCGATGGTGAATTTAATCCTTATGAGGTGCTAGGTGTAAGCCCTATTGAGAAATTTGACATGGTCAAGGCAGCATATGCTAAAAAAAAGAAGGAGGCTGAGATGAACGGCGATGAAGCAACTGCTTCTAGACTGGAAAAGGCATATGACAAACTCATGATGGCTCAATTGTCTAATCGGAAAAAGGGTGTGACTTTTGGATCATTTAAGGTTTCAAAGGAGATCAAGTATGCGGACAAGCTTCCAGTTATACCTTGGGGGCCAAGGTTTACTAAATCAAGTCAAAATGACATGCGCATCAACTTGGCAATATCTGCTGTTTTTACAGCTTGGATCCTTGTCAAGCGCAGTGCTGAATATAAACCTTTGCAGTTTTTAGCCTTTGCCTTTGTTTATAGGCTTTTTGAGAAGTTAAAAACCTTTGAATCTCCTGTAACCCCCAAATATAATGAAGAGGGTGAAGACACAGGCGAAGGACTCCGCATGGGAAAACGATTGCTTCGATCACTGGCCTTGGTTTTTGGATGTGTAGCTATTTCATCTTTGGCATACACTTTCATTTTGAACATAATTGAGTTTGCAGGTGGTTTTATTCCTACTCTTTTGTACAACAGTCAGGAGTTGATAATCACCACATCGTCGGCACTCATGCTTTATATCATGGCATCTTATTATAGATAG
Predicted protein sequences of Glyma19g43750
>Glyma19g43750.1   sequence type=predicted peptide   gene model=Glyma19g43750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALGISNILHCPKLSFSHNNFRPKVSTSLSLRFPQTAARSDRKIICAAASAAGSSNPDGEFNPYEVLGVSPIEKFDMVKAAYAKKKKEAEMNGDEATASRLEKAYDKLMMAQLSNRKKGVTFGSFKVSKEIKYADKLPVIPWGPRFTKSSQNDMRINLAISAVFTAWILVKRSAEYKPLQFLAFAFVYRLFEKLKTFESPVTPKYNEEGEDTGEGLRMGKRLLRSLALVFGCVAISSLAYTFILNIIEFAGGFIPTLLYNSQELIITTSSALMLYIMASYYR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo