SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g43430): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g43430): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g43430

Feature Type:gene_model
Chromosome:Gm19
Start:49085323
stop:49086754
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g43430
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G28750AT Annotation by Michelle Graham. TAIR10: Bacterial sec-independent translocation protein mttA/Hcf106 | chr5:10784142-10785677 REVERSE LENGTH=147 SoyBaseE_val: 2.00E-36ISS
GO:0009306GO-bp Annotation by Michelle Graham. GO Biological Process: protein secretion SoyBaseN/AISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0033281GO-cc Annotation by Michelle Graham. GO Cellular Compartment: TAT protein transport complex SoyBaseN/AISS
GO:0008565GO-mf Annotation by Michelle Graham. GO Molecular Function: protein transporter activity SoyBaseN/AISS
PF02416PFAM mttA/Hcf106 family JGI ISS
UniRef100_C6SZ58UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SZ58_SOYBN SoyBaseE_val: 5.00E-95ISS
UniRef100_Q9XH46UniRef Annotation by Michelle Graham. Most informative UniRef hit: Sec-independent protein translocase protein TATA, chloroplastic n=1 Tax=Pisum sativum RepID=TATA_PEA SoyBaseE_val: 5.00E-36ISS

Expression Patterns of Glyma19g43430
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g43430 not represented in the dataset
Glyma19g43430 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g43430
ParalogEvidenceComments
Glyma03g40740 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g43430 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g244900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g43430
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g43430
>Glyma19g43430.1   sequence type=CDS   gene model=Glyma19g43430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGACGATGATGATGAGTTGCGTATCGATTCCGAGTTCAATTCCAAAATCAAGACCTTCTATTAGCTTGGGTTTGGGAACTCCCAAGTTGTTCAATTCAGTTTCAGTAAGGGTAGCCGTGAACGTGAATGGTCGGGGAAGAAACAAAGGTTTGAGTTGCAACGCCATGTTCGGTCTGGGCGTGCCTGAACTGGTCGTTATTGCCGGCGTGGCCGCCCTCGTTTTTGGGCCCAAGAAATTGCCTGAAGTCGGCCGCAGCATCGGCAAAACTGTCAAGAGCTTCCAACAGGCTGCAAAGGAGTTTGAGTCGGAGCTTAAGAAGGAACCGGATTCCACCGAAGGGGACTCATCTGAGAAATCTATTGTAGTCAGTGAGAAGCAGCAGCAGCAGGACAATGAGGTGTCTACTTCTAAGGAGACTGTATGA
Predicted protein sequences of Glyma19g43430
>Glyma19g43430.1   sequence type=predicted peptide   gene model=Glyma19g43430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
METMMMSCVSIPSSIPKSRPSISLGLGTPKLFNSVSVRVAVNVNGRGRNKGLSCNAMFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTVKSFQQAAKEFESELKKEPDSTEGDSSEKSIVVSEKQQQQDNEVSTSKETV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo