Glyma19g43170 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g43170): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g43170): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g43170

Feature Type:	gene_model
Chromosome:	Gm19
Start:	48908071
stop:	48908999
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g43170

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G54500	AT	Annotation by Michelle Graham. TAIR10: Rubredoxin-like superfamily protein \| chr1:20357084-20357671 REVERSE LENGTH=195	SoyBase	E_val: 4.00E-14	ISS
GO:0009773	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I	SoyBase	N/A	ISS
GO:0009965	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis	SoyBase	N/A	ISS
GO:0030154	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell differentiation	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0046872	GO-mf	Annotation by Michelle Graham. GO Molecular Function: metal ion binding	SoyBase	N/A	ISS
PF00301	PFAM	Rubredoxin	JGI		ISS
UniRef100_G7L0U0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Rubredoxin n=1 Tax=Medicago truncatula RepID=G7L0U0_MEDTR	SoyBase	E_val: 5.00E-14	ISS
UniRef100_I1NC69	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1NC69_SOYBN	SoyBase	E_val: 3.00E-59	ISS

Expression Patterns of Glyma19g43170

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g43170 not represented in the dataset	Glyma19g43170 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g43170

Paralog	Evidence	Comments
Glyma03g40510	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g43170 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma19g43170

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g43170

Limit To All Plant Sequences

>Glyma19g43170.1   sequence type=CDS   gene model=Glyma19g43170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AGTCAAACTGTCAATCATAAGACACGCCCGCGTCCCTTACCGCCCGGCTACCAGTTCGAGAAGCTTCCGGATGATTGGCGCTGCCCCACGTGTGGGGCCGCCCAGAGTTTCTTCCAGAGCAAGAGCGTCCAGACTCCAGATCGCTGGGTTTGCGCAGAACCAGCAATATGGGCTTGGTGGCAATTCTCTCACTTCGGCCCAGAAGACTCTTTTTATATACGGCACTTGTTCTTCTTTTCCCTCTTTTTGGGTGGCTACTTCCTACAATAG

Predicted protein sequences of Glyma19g43170

Limit To All Plant Sequences

>Glyma19g43170.1   sequence type=predicted peptide   gene model=Glyma19g43170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SQTVNHKTRPRPLPPGYQFEKLPDDWRCPTCGAAQSFFQSKSVQTPDRWVCAEPAIWAWWQFSHFGPEDSFYIRHLFFFSLFLGGYFLQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain