Report for Sequence Feature Glyma19g43030
Feature Type: gene_model
Chromosome: Gm19
Start: 48823140
stop: 48823931
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma19g43030
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G22560 AT
Annotation by Michelle Graham. TAIR10: Acyl-CoA N-acyltransferases (NAT) superfamily protein | chr3:7998915-7999442 REVERSE LENGTH=175
SoyBase E_val: 4.00E-65 ISS
GO:0008152 GO-bp
Annotation by Michelle Graham. GO Biological Process: metabolic process
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0016020 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: membrane
SoyBase N/A ISS
GO:0008080 GO-mf
Annotation by Michelle Graham. GO Molecular Function: N-acetyltransferase activity
SoyBase N/A ISS
PF00583 PFAM
Acetyltransferase (GNAT) family
JGI ISS
UniRef100_C6T3M3 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T3M3_SOYBN
SoyBase E_val: 1.00E-126 ISS
UniRef100_G7L0S4 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: N-acetyltransferase, putative n=1 Tax=Medicago truncatula RepID=G7L0S4_MEDTR
SoyBase E_val: 4.00E-101 ISS
Expression Patterns of Glyma19g43030
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma19g43030 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.19g241500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma19g43030
Coding sequences of Glyma19g43030
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma19g43030.1 sequence type=CDS gene model=Glyma19g43030 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCAAGGGTGGATCTCTCCAGGATTAGTCTCCGACCATTCAAGATGAGTGATGTTGACGATTTCTTGATATGGGCAGGGGATGATCAAGTGACTCGAAACCTCCGATGGAAGACGTGTGGTTCAAGGGAAGAGGCTCTGGCCTTCATAAGGGATGTTTGCATACCTCACCCATGGCGTAGATCAATCTGCCTTGATGACCGTTCCATCGGCTTTGTTTCGGTGTATCCTTGGTCGGGCGATGAAAGGTGCAAGGCCGACATAGGCTATGCTATTGGGACCAACTACTGGGGCCAAGGGATAGCTACCAAAGCACTCATGACTGCAGTGCCTCAAGTCTTCAAGGACTTTAACGAATTGCTAAGGTTGCAGGCTTTTGTTGATGTTGAGAACAAGGCTTCTCAGAGGGTGTTGGAAAAGGCTGGGTTCCTTAGAGAGGGTGTCCTCAGAAAGTACACTTATCTTAAGGGGGTTGTTAAGGATTTGGTTTTGTATAGTTTTTTGTCAACGGATGAAATTACTTCTTGTGACTAG
Predicted protein sequences of Glyma19g43030
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma19g43030.1 sequence type=predicted peptide gene model=Glyma19g43030 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MARVDLSRISLRPFKMSDVDDFLIWAGDDQVTRNLRWKTCGSREEALAFIRDVCIPHPWRRSICLDDRSIGFVSVYPWSGDERCKADIGYAIGTNYWGQGIATKALMTAVPQVFKDFNELLRLQAFVDVENKASQRVLEKAGFLREGVLRKYTYLKGVVKDLVLYSFLSTDEITSCD*