Report for Sequence Feature Glyma19g42480
Feature Type: gene_model
Chromosome: Gm19
Start: 48427851
stop: 48431590
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma19g42480
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G27430 AT
Annotation by Michelle Graham. TAIR10: Signal peptidase subunit | chr5:9687470-9689185 FORWARD LENGTH=167
SoyBase E_val: 3.00E-105 ISS
GO:0006465 GO-bp
Annotation by Michelle Graham. GO Biological Process: signal peptide processing
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0005618 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cell wall
SoyBase N/A ISS
GO:0005787 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: signal peptidase complex
SoyBase N/A ISS
GO:0016021 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane
SoyBase N/A ISS
GO:0008233 GO-mf
Annotation by Michelle Graham. GO Molecular Function: peptidase activity
SoyBase N/A ISS
KOG3372
KOG
Signal peptidase complex subunit
JGI ISS
PTHR12804 Panther
MICROSOMAL SIGNAL PEPTIDASE 23 KD SUBUNIT (SPC22/23)
JGI ISS
PF04573 PFAM
Signal peptidase subunit
JGI ISS
UniRef100_B9RF33 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Microsomal signal peptidase 23 kD subunit, putative n=1 Tax=Ricinus communis RepID=B9RF33_RICCO
SoyBase E_val: 5.00E-111 ISS
UniRef100_I1NC08 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NC08_SOYBN
SoyBase E_val: 2.00E-122 ISS
Expression Patterns of Glyma19g42480
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma19g42480
Paralog Evidence Comments
Glyma03g39930 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma19g42480 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.19g236500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma19g42480
Coding sequences of Glyma19g42480
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma19g42480.1 sequence type=CDS gene model=Glyma19g42480 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCATTCATTCGGCTACAGAGCCAACGCGTTGCTAACCTTTGCCGTAACCATTCTGGCGCTTATGTGCGCTATGGCTTCTGTATCCGACAACTTCAACACCCCCACTCCCTCTGCACAAGTCCAGGTTCTGAACATCAACTGGTTTCAGAAACAACCCAATGGCAACGACGAGGTCAGCATGACGATGAATATTTCCGCAGACTTGCAGTCCCTTTTCACATGGAACACAAAACAGGTTTTTGTTTTTCTAGCTGCTGAGTATGAAACTCCTAAGAATTCCTTGAATCAGATATCCCTATGGGATGGTATCATTCCCTCTAAAGAGCATGCAAAGTTTTGGATTCATACATCAAATAAATACCGCTTCATCGACCAGGGGAGCAATTTGCGTGGCAAAGAATATAACCTGACTATGCATTGGCATGTTATGCCGAAGACTGGCAAAATGTTTGCTGATAAAATAGTCATGCCAGGTTATCGATTGCCTCAGGAATATAGATGA
Predicted protein sequences of Glyma19g42480
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma19g42480.1 sequence type=predicted peptide gene model=Glyma19g42480 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MHSFGYRANALLTFAVTILALMCAMASVSDNFNTPTPSAQVQVLNINWFQKQPNGNDEVSMTMNISADLQSLFTWNTKQVFVFLAAEYETPKNSLNQISLWDGIIPSKEHAKFWIHTSNKYRFIDQGSNLRGKEYNLTMHWHVMPKTGKMFADKIVMPGYRLPQEYR*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
