SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g41820

Feature Type:gene_model
Chromosome:Gm19
Start:47992555
stop:47993595
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g41820
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G02070AT Annotation by Michelle Graham. TAIR10: Protein kinase family protein | chr5:405895-408220 REVERSE LENGTH=657 SoyBaseE_val: 5.00E-38ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
UniRef100_G7KWJ0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Wall-associated receptor kinase-like protein n=1 Tax=Medicago truncatula RepID=G7KWJ0_MEDTR SoyBaseE_val: 5.00E-108ISS
UniRef100_I1NBT6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NBT6_SOYBN SoyBaseE_val: 1.00E-149ISS

Expression Patterns of Glyma19g41820
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g41820 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g230300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g41820
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g41820
>Glyma19g41820.1   sequence type=CDS   gene model=Glyma19g41820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATAGCCTTTCTACTCTTTCTACTAACTAGTCTTGGTCTAGTAATCAATGCATCAACCTTTAGTGCTTGTTCGAATTGTGGAGACTTTGTAGTCCCATACCCACTCAGCACTAACGAGGACTGTGGAGACAATAGGTACAAAGTCTACTGCAACGATGGAAATTTAGAGTTCTTGTCAGCAACAGGGACTTACTATAAGATCCTTAGAATTGACCCAAGTGCTAACAAGCTTGTCATTAGCCCACCTCCTATACTGAAAAACACTTGTTATTCTTCTGATCTCTATATGGGAGGCTTGTTGCTTGATGAAAGCTTGCCCTTCAATATATCTACACAAAACACGGTCATGTTGTTTAATTGCTCTTATAATATCCTTCAGTCTCCATTGAATTGTTCTTCAAATAGTATTTGCAGGCAATTTGAGGAAAAGGTGGAAGAAGGAACTGGGTGTATGGACACCCTTTGTTGCCATTACTTAAAGGACTCAGCCATGAATTCCCACAAGATTAGGGTAAAGGTTGGGAGTTGCACTGCTTATACTTGTTTGGTTGGTTTCAAGCCTAATGACCAACTTGAAACTTGGAATTATGGGATTGAGCTACAATGGTTGTCTCCCAATTGA
Predicted protein sequences of Glyma19g41820
>Glyma19g41820.1   sequence type=predicted peptide   gene model=Glyma19g41820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIAFLLFLLTSLGLVINASTFSACSNCGDFVVPYPLSTNEDCGDNRYKVYCNDGNLEFLSATGTYYKILRIDPSANKLVISPPPILKNTCYSSDLYMGGLLLDESLPFNISTQNTVMLFNCSYNILQSPLNCSSNSICRQFEEKVEEGTGCMDTLCCHYLKDSAMNSHKIRVKVGSCTAYTCLVGFKPNDQLETWNYGIELQWLSPN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo