Glyma19g41580 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g41580

Feature Type:	gene_model
Chromosome:	Gm19
Start:	47808304
stop:	47808852
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g41580

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G09250	AT	Annotation by Michelle Graham. TAIR10: basic helix-loop-helix (bHLH) DNA-binding superfamily protein \| chr1:2989509-2990132 FORWARD LENGTH=207	SoyBase	E_val: 4.00E-32	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
UniRef100_B9RFK5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor, putative n=1 Tax=Ricinus communis RepID=B9RFK5_RICCO	SoyBase	E_val: 1.00E-31	ISS
UniRef100_I1NBQ9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NBQ9_SOYBN	SoyBase	E_val: 3.00E-129	ISS

Expression Patterns of Glyma19g41580

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g41580

Paralog	Evidence	Comments
Glyma03g39010	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g41580 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g228000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g41580

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g41580

Limit To All Plant Sequences

>Glyma19g41580.1   sequence type=CDS   gene model=Glyma19g41580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACTCTTTGTCTTTGCACTCAAACCTCCATTCCGTTAACAATAAGCGCCGCCAAATCACACACCAAAACTCCTTCGCTCTCACTCCCTCCTGGACTTCCCTAACCGAACAGCGCCTCTACTCCTCCAAGCTCCTCCACTCGCTCCGCCGCAACAGCAACCCTACCGCCGCCCTCGAAGTCCGCGCCTCCGCTGACCGCGTCCTCGCCGCCACTGCCAAAGGCCGAACTCGCTGGAGCCGCGCCATTCTCTCAAATCCGATCTGCCGCTGGAAGCAGAGACACCACAAGAAGGTCAAGAAGTACTCCGCCAACAAATTCATGAAGAAGACGACGCCTGAGATTCGGAGAAGCTTGCCGGCTGTGCAGAAGAAAGCGCGCGTTCTCGGAAAGTTAATTCCTGGTTGCCGGAAGGTGTCGTTCCCGAAGCTTCTAGAAGAAGCCGGTGACTATATTTCGGCGTTGGAGATGCAAGTGCGAGCCATGAAGGCTCTCGCCGACCTCCTCGCCACCGGTGCTCCGCCGCCAGCTCCGATCGGTTTGAGTTGA

Predicted protein sequences of Glyma19g41580

Limit To All Plant Sequences

>Glyma19g41580.1   sequence type=predicted peptide   gene model=Glyma19g41580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDSLSLHSNLHSVNNKRRQITHQNSFALTPSWTSLTEQRLYSSKLLHSLRRNSNPTAALEVRASADRVLAATAKGRTRWSRAILSNPICRWKQRHHKKVKKYSANKFMKKTTPEIRRSLPAVQKKARVLGKLIPGCRKVSFPKLLEEAGDYISALEMQVRAMKALADLLATGAPPPAPIGLS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain