SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma19g41580

Feature Type:gene_model
Chromosome:Gm19
Start:47808304
stop:47808852
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G09250AT Annotation by Michelle Graham. TAIR10: basic helix-loop-helix (bHLH) DNA-binding superfamily protein | chr1:2989509-2990132 FORWARD LENGTH=207 SoyBaseE_val: 4.00E-32ISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
UniRef100_B9RFK5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor, putative n=1 Tax=Ricinus communis RepID=B9RFK5_RICCO SoyBaseE_val: 1.00E-31ISS
UniRef100_I1NBQ9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NBQ9_SOYBN SoyBaseE_val: 3.00E-129ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma03g39010 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g228000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g41580.1   sequence type=CDS   gene model=Glyma19g41580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACTCTTTGTCTTTGCACTCAAACCTCCATTCCGTTAACAATAAGCGCCGCCAAATCACACACCAAAACTCCTTCGCTCTCACTCCCTCCTGGACTTCCCTAACCGAACAGCGCCTCTACTCCTCCAAGCTCCTCCACTCGCTCCGCCGCAACAGCAACCCTACCGCCGCCCTCGAAGTCCGCGCCTCCGCTGACCGCGTCCTCGCCGCCACTGCCAAAGGCCGAACTCGCTGGAGCCGCGCCATTCTCTCAAATCCGATCTGCCGCTGGAAGCAGAGACACCACAAGAAGGTCAAGAAGTACTCCGCCAACAAATTCATGAAGAAGACGACGCCTGAGATTCGGAGAAGCTTGCCGGCTGTGCAGAAGAAAGCGCGCGTTCTCGGAAAGTTAATTCCTGGTTGCCGGAAGGTGTCGTTCCCGAAGCTTCTAGAAGAAGCCGGTGACTATATTTCGGCGTTGGAGATGCAAGTGCGAGCCATGAAGGCTCTCGCCGACCTCCTCGCCACCGGTGCTCCGCCGCCAGCTCCGATCGGTTTGAGTTGA

>Glyma19g41580.1   sequence type=predicted peptide   gene model=Glyma19g41580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDSLSLHSNLHSVNNKRRQITHQNSFALTPSWTSLTEQRLYSSKLLHSLRRNSNPTAALEVRASADRVLAATAKGRTRWSRAILSNPICRWKQRHHKKVKKYSANKFMKKTTPEIRRSLPAVQKKARVLGKLIPGCRKVSFPKLLEEAGDYISALEMQVRAMKALADLLATGAPPPAPIGLS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo