|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G09270 | AT | Annotation by Michelle Graham. TAIR10: importin alpha isoform 4 | chr1:2995162-2997833 FORWARD LENGTH=456 | SoyBase | E_val: 8.00E-41 | ISS |
GO:0006007 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glucose catabolic process | SoyBase | N/A | ISS |
GO:0006499 | GO-bp | Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation | SoyBase | N/A | ISS |
GO:0006606 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein import into nucleus | SoyBase | N/A | ISS |
GO:0006612 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane | SoyBase | N/A | ISS |
GO:0006820 | GO-bp | Annotation by Michelle Graham. GO Biological Process: anion transport | SoyBase | N/A | ISS |
GO:0006862 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nucleotide transport | SoyBase | N/A | ISS |
GO:0006886 | GO-bp | Annotation by Michelle Graham. GO Biological Process: intracellular protein transport | SoyBase | N/A | ISS |
GO:0006888 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport | SoyBase | N/A | ISS |
GO:0010363 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response | SoyBase | N/A | ISS |
GO:0015696 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ammonium transport | SoyBase | N/A | ISS |
GO:0015802 | GO-bp | Annotation by Michelle Graham. GO Biological Process: basic amino acid transport | SoyBase | N/A | ISS |
GO:0030581 | GO-bp | Annotation by Michelle Graham. GO Biological Process: symbiont intracellular protein transport in host | SoyBase | N/A | ISS |
GO:0043069 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death | SoyBase | N/A | ISS |
GO:0043090 | GO-bp | Annotation by Michelle Graham. GO Biological Process: amino acid import | SoyBase | N/A | ISS |
GO:0043269 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of ion transport | SoyBase | N/A | ISS |
GO:0080034 | GO-bp | Annotation by Michelle Graham. GO Biological Process: host response to induction by symbiont of tumor, nodule or growth in host | SoyBase | N/A | ISS |
GO:0005622 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: intracellular | SoyBase | N/A | ISS |
GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
GO:0008565 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein transporter activity | SoyBase | N/A | ISS |
PTHR23316 | Panther | IMPORTIN ALPHA-RELATED | JGI | ISS | |
PF00514 | PFAM | Armadillo/beta-catenin-like repeat | JGI | ISS | |
UniRef100_I1JR45 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Importin subunit alpha n=1 Tax=Glycine max RepID=I1JR45_SOYBN | SoyBase | E_val: 6.00E-45 | ISS |
UniRef100_UPI000233E74D | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233E74D related cluster n=1 Tax=unknown RepID=UPI000233E74D | SoyBase | E_val: 2.00E-79 | ISS |
Glyma19g41555 not represented in the dataset |
Glyma19g41555 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g41555.1 sequence type=CDS gene model=Glyma19g41555 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high GTTGTCTTTGATGCCAATGTTATTCCTCCTCTTGTTCAAATTCTTCAACATTCTGAGTTTGACGTCAAGAAGGCGGCTGCCAGGGCCATCTTCTACGTGACTTCTGAAGGATCTCAAGACCATATCAGGTACCTGGCATATGAAGAAGGTTGCATTAAGGGACTATGTGATCTGTTGAGCTGTCCAGACCCAATGGTTGTGTCAACTTGTCTTGAGGGGCTGGAGAACATTTTGAGGGTCGGAGAAGCTGACAAGGAAATGGGTGTCAATGTTTTTGTTCAAAGGGTTCATGAATATGAAGGATGGGATAAGATTGAATTTTTTATGAATCATTGGAACAATGAGATTTCTCAGAGAGCTGTGAGGATTGTGGAAGAAATGAAGAATGATGCTAGTCCGTAA
>Glyma19g41555.1 sequence type=predicted peptide gene model=Glyma19g41555 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high VVFDANVIPPLVQILQHSEFDVKKAAARAIFYVTSEGSQDHIRYLAYEEGCIKGLCDLLSCPDPMVVSTCLEGLENILRVGEADKEMGVNVFVQRVHEYEGWDKIEFFMNHWNNEISQRAVRIVEEMKNDASP*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||