SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g41510

Feature Type:gene_model
Chromosome:Gm19
Start:47767341
stop:47768418
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g41510
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G15510AT Annotation by Michelle Graham. TAIR10: Photosystem II reaction center PsbP family protein | chr4:8860701-8862529 FORWARD LENGTH=287 SoyBaseE_val: 9.00E-87ISS
GO:0048564GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem I assembly SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009543GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009654GO-cc Annotation by Michelle Graham. GO Cellular Compartment: oxygen evolving complex SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0030095GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast photosystem II SoyBaseN/AISS
GO:0031977GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF01789PFAM PsbP JGI ISS
UniRef100_B9RFL8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Thylakoid lumenal 21.5 kDa protein, chloroplast, putative n=1 Tax=Ricinus communis RepID=B9RFL8_RICCO SoyBaseE_val: 5.00E-98ISS
UniRef100_UPI000233E8AAUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E8AA related cluster n=1 Tax=unknown RepID=UPI000233E8AA SoyBaseE_val: 2.00E-133ISS

Expression Patterns of Glyma19g41510
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g41510 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g227400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g41510
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g41510
>Glyma19g41510.1   sequence type=CDS   gene model=Glyma19g41510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGCTGCAGAGAGTAACTTGGCTGTTGATAAAGAGAATCATGCTAAAGCTTTTGCAGTTCCAAGGAGGAAAGCAATGTCATTGATCTTATCAAGTTACGTTCTATCAGAGGTTGGTTTAGCATTGGCTCAACAGTCTCCTGTGTTCCGTGAATACATAGACGCATTCGATGGTTGTTCATTCCAGTACCCGGGGAGTTGGATTCAAGTCCGAGGTGCCGGGGCTGACATATTCTTCAGGGACCCTTTTGTTCTTGATGAAAATCTATCTAATGTTGAAGACTTGGGTGCACCTCAAGAAGCTGGAAAGAAAGTGCTCAAACAGTATCTGACTGAGTTTATGTCCACTAGACTCGGCGTTAGACGTGAATCAAATATTCTTTCCACATCTTCAAGAGTAACTGATGATGGAAGGTTATACTATCAAATTGAGGTAAACATAAAGTCATATGCCAATAACAATGAGCTTGCTGTTATGCCAGAAGACCGAGTGGTACGTCTGGAATGGGATCCGAGGTACCTATCTGTTCTTGGGGTTGAAAACAACCAATTGTATGAGTTGAGATTGCAG
Predicted protein sequences of Glyma19g41510
>Glyma19g41510.1   sequence type=predicted peptide   gene model=Glyma19g41510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEAAESNLAVDKENHAKAFAVPRRKAMSLILSSYVLSEVGLALAQQSPVFREYIDAFDGCSFQYPGSWIQVRGAGADIFFRDPFVLDENLSNVEDLGAPQEAGKKVLKQYLTEFMSTRLGVRRESNILSTSSRVTDDGRLYYQIEVNIKSYANNNELAVMPEDRVVRLEWDPRYLSVLGVENNQLYELRLQ






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo