Glyma19g41482 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g41482): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g41482): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g41482

Feature Type:	gene_model
Chromosome:	Gm19
Start:	47742265
stop:	47742759
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g41482

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G06720	AT	Annotation by Michelle Graham. TAIR10: importin alpha isoform 1 \| chr3:2120559-2123555 FORWARD LENGTH=532	SoyBase	E_val: 6.00E-39	ISS
GO:0006094	GO-bp	Annotation by Michelle Graham. GO Biological Process: gluconeogenesis	SoyBase	N/A	ISS
GO:0006606	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein import into nucleus	SoyBase	N/A	ISS
GO:0006886	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular protein transport	SoyBase	N/A	ISS
GO:0007010	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization	SoyBase	N/A	ISS
GO:0010498	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process	SoyBase	N/A	ISS
GO:0048767	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair elongation	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005635	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nuclear envelope	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0008565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein transporter activity	SoyBase	N/A	ISS
PTHR23316	Panther	IMPORTIN ALPHA-RELATED	JGI		ISS
PF00514	PFAM	Armadillo/beta-catenin-like repeat	JGI		ISS
UniRef100_I1JR45	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Importin subunit alpha n=1 Tax=Glycine max RepID=I1JR45_SOYBN	SoyBase	E_val: 9.00E-43	ISS
UniRef100_UPI000233E74D	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E74D related cluster n=1 Tax=unknown RepID=UPI000233E74D	SoyBase	E_val: 3.00E-83	ISS

Expression Patterns of Glyma19g41482

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g41482 not represented in the dataset	Glyma19g41482 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g41482 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma19g41482

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g41482

Limit To All Plant Sequences

>Glyma19g41482.1   sequence type=CDS   gene model=Glyma19g41482   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTTGTCTTTGATGCCAATTTTATTCCTCCTCTTGTTCAAATTCTTCAACATTCTGAGTTTGACGTCAAGAAGGCGGCTGCCAGGGCCATCTTCTACGTGACTTCTGAAGGATCTCAAGACCATATCAGGTACCTGGCATATGAAGAAGGTTGCATTAAGGGACTATGTGATCTGTTGAGCTGTCCAGACCCAATGGTAGTGTCAACTTGTCTTGAGGGGCTGGAGAACATTTTGAGGGTCGGAGACGCTGACAAGGAAATGGGTGTCAATGTTTTTGTTCAAAGGGTTCATAAATATGAAGGATGGGATAAGATTGAAATTTTTATGAATCATTGGAACAATGAGATTTCTCTGAGAGCTGTGAGGATTGTGGAAGAAATGAAGAATGATGCTAGTCCCTAA

Predicted protein sequences of Glyma19g41482

Limit To All Plant Sequences

>Glyma19g41482.1   sequence type=predicted peptide   gene model=Glyma19g41482   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VVFDANFIPPLVQILQHSEFDVKKAAARAIFYVTSEGSQDHIRYLAYEEGCIKGLCDLLSCPDPMVVSTCLEGLENILRVGDADKEMGVNVFVQRVHKYEGWDKIEIFMNHWNNEISLRAVRIVEEMKNDASP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain