SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g40700): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g40700): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g40700

Feature Type:gene_model
Chromosome:Gm19
Start:47041841
stop:47045665
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g40700
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G01900AT Annotation by Michelle Graham. TAIR10: GLNB1 homolog | chr4:821736-823294 FORWARD LENGTH=196 SoyBaseE_val: 1.00E-73ISS
GO:0000096GO-bp Annotation by Michelle Graham. GO Biological Process: sulfur amino acid metabolic process SoyBaseN/AISS
GO:0006546GO-bp Annotation by Michelle Graham. GO Biological Process: glycine catabolic process SoyBaseN/AISS
GO:0006636GO-bp Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process SoyBaseN/AISS
GO:0006733GO-bp Annotation by Michelle Graham. GO Biological Process: oxidoreduction coenzyme metabolic process SoyBaseN/AISS
GO:0006766GO-bp Annotation by Michelle Graham. GO Biological Process: vitamin metabolic process SoyBaseN/AISS
GO:0006807GO-bp Annotation by Michelle Graham. GO Biological Process: nitrogen compound metabolic process SoyBaseN/AISS
GO:0006808GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of nitrogen utilization SoyBaseN/AISS
GO:0006816GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transport SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0008652GO-bp Annotation by Michelle Graham. GO Biological Process: cellular amino acid biosynthetic process SoyBaseN/AISS
GO:0009072GO-bp Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family metabolic process SoyBaseN/AISS
GO:0009106GO-bp Annotation by Michelle Graham. GO Biological Process: lipoate metabolic process SoyBaseN/AISS
GO:0009108GO-bp Annotation by Michelle Graham. GO Biological Process: coenzyme biosynthetic process SoyBaseN/AISS
GO:0009117GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide metabolic process SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009416GO-bp Annotation by Michelle Graham. GO Biological Process: response to light stimulus SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0009718GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin-containing compound biosynthetic process SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009749GO-bp Annotation by Michelle Graham. GO Biological Process: response to glucose stimulus SoyBaseN/AISS
GO:0009750GO-bp Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019748GO-bp Annotation by Michelle Graham. GO Biological Process: secondary metabolic process SoyBaseN/AISS
GO:0042304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of fatty acid biosynthetic process SoyBaseN/AISS
GO:0044272GO-bp Annotation by Michelle Graham. GO Biological Process: sulfur compound biosynthetic process SoyBaseN/AISS
GO:2000013GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of arginine biosynthetic process via ornithine SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0000287GO-mf Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0010307GO-mf Annotation by Michelle Graham. GO Molecular Function: acetylglutamate kinase regulator activity SoyBaseN/AISS
GO:0030234GO-mf Annotation by Michelle Graham. GO Molecular Function: enzyme regulator activity SoyBaseN/AISS
PF00543PFAM Nitrogen regulatory protein P-II JGI ISS
UniRef100_C6TCD9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TCD9_SOYBN SoyBaseE_val: 1.00E-137ISS
UniRef100_Q9ARI4UniRef Annotation by Michelle Graham. Most informative UniRef hit: PII protein n=1 Tax=Medicago sativa RepID=Q9ARI4_MEDSA SoyBaseE_val: 3.00E-102ISS

Expression Patterns of Glyma19g40700
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g40700 not represented in the dataset
Glyma19g40700 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g40700
ParalogEvidenceComments
Glyma03g38100 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g40700 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g219300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g40700
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Transcripts of Glyma19g40700
>Glyma19g40700.2   sequence type=transcript   gene model=Glyma19g40700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAAAAATAAAATTTGTCTGGGTTGAAACTTGAAACTTGAAAAGCGGCGTTTGCTCCGACCGAGTGCTTCAGAGGAGAAGTAATGACTGCGATCGCGGGAACGCACGTTTTTGGTGTTGTGAGTTTTCAGCTCAAACAAGCTGAAATGCCTTTTGCATGTTCTTGCTTAATCCGCAAGCGTATTGGAGATTCTCCTCAGCGCAATGTGGCTCTAAGACGCAGAGTAAATGGAACAATTCTTCCCCAAATCAGAGCCCAGAATCTTCCAGATTATGTTCCAAAATCCGAGTTTTACAAAGTAGAAGCGATTCTCAGGCCATGGCGAGTTCCCCAGGTTTCTGCGGCTTTGTTGAAAATGGGAATTCGTGGTGTCACTGTATCTGATGTCAGGGGCTTTGGTGCTCAGGGTGGTTCAAAAGAGAGGCAGGGAGGCTCCGAATTTTCAGAAGACAATTTTGTTGCCAAAGTTAAAATGGAAGTAGTGGTGAGAAAGGACCAGGTAAGGTAGAATGTAGACATTTGGCAGTAACATCACTGCTTCATACACTCTAATTGACTTTG
Coding sequences of Glyma19g40700
>Glyma19g40700.1   sequence type=CDS   gene model=Glyma19g40700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTGCGATCGCGGGAACGCACGTTTTTGGTGTTGTGAGTTTTCAGCTCAAACAAGCTGAAATGCCTTTTGCATGTTCTTGCTTAATCCGCAAGCGTATTGGAGATTCTCCTCAGCGCAATGTGGCTCTAAGACGCAGAGTAAATGGAACAATTCTTCCCCAAATCAGAGCCCAGAATCTTCCAGATTATGTTCCAAAATCCGAGTTTTACAAAGTAGAAGCGATTCTCAGGCCATGGCGAGTTCCCCAGGTTTCTGCGGCTTTGTTGAAAATGGGAATTCGTGGTGTCACTGTATCTGATGTCAGGGGCTTTGGTGCTCAGGGTGGTTCAAAAGAGAGGCAGGGAGGCTCCGAATTTTCAGAAGACAATTTTGTTGCCAAAGTTAAAATGGAAGTAGTGGTGAGAAAGGACCAGGTTGAGGCAGTTATTGACAAAATTATTGAGGAGGCAAGAACTGGGGAGATTGGTGATGGCAAAATTTTCTTGATCCCCATCTCAGATGTTATAAGAATTCGGACAGGTGAACGTGGGGAGCAGGCAGCTAGGATGACTGGGGGCCGAAGTGACATGTTATCTGCTGTATGA

>Glyma19g40700.2   sequence type=CDS   gene model=Glyma19g40700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTGCGATCGCGGGAACGCACGTTTTTGGTGTTGTGAGTTTTCAGCTCAAACAAGCTGAAATGCCTTTTGCATGTTCTTGCTTAATCCGCAAGCGTATTGGAGATTCTCCTCAGCGCAATGTGGCTCTAAGACGCAGAGTAAATGGAACAATTCTTCCCCAAATCAGAGCCCAGAATCTTCCAGATTATGTTCCAAAATCCGAGTTTTACAAAGTAGAAGCGATTCTCAGGCCATGGCGAGTTCCCCAGGTTTCTGCGGCTTTGTTGAAAATGGGAATTCGTGGTGTCACTGTATCTGATGTCAGGGGCTTTGGTGCTCAGGGTGGTTCAAAAGAGAGGCAGGGAGGCTCCGAATTTTCAGAAGACAATTTTGTTGCCAAAGTTAAAATGGAAGTAGTGGTGAGAAAGGACCAGGTAAGGTAG
Predicted protein sequences of Glyma19g40700
>Glyma19g40700.1   sequence type=predicted peptide   gene model=Glyma19g40700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTAIAGTHVFGVVSFQLKQAEMPFACSCLIRKRIGDSPQRNVALRRRVNGTILPQIRAQNLPDYVPKSEFYKVEAILRPWRVPQVSAALLKMGIRGVTVSDVRGFGAQGGSKERQGGSEFSEDNFVAKVKMEVVVRKDQVEAVIDKIIEEARTGEIGDGKIFLIPISDVIRIRTGERGEQAARMTGGRSDMLSAV*

>Glyma19g40700.2   sequence type=predicted peptide   gene model=Glyma19g40700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTAIAGTHVFGVVSFQLKQAEMPFACSCLIRKRIGDSPQRNVALRRRVNGTILPQIRAQNLPDYVPKSEFYKVEAILRPWRVPQVSAALLKMGIRGVTVSDVRGFGAQGGSKERQGGSEFSEDNFVAKVKMEVVVRKDQVR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo