SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g40190): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g40190): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g40190

Feature Type:gene_model
Chromosome:Gm19
Start:46639334
stop:46640252
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g40190
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G47485AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G62650.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). | chr2:19486004-19486429 FORWARD LENGTH=141 SoyBaseE_val: 2.00E-25ISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
PTHR25061Panther FAMILY NOT NAMED JGI ISS
PTHR25061:SF42Panther JGI ISS
UniRef100_D7LGN5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Binding protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LGN5_ARALL SoyBaseE_val: 5.00E-22ISS
UniRef100_I1NBA4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NBA4_SOYBN SoyBaseE_val: 4.00E-102ISS

Expression Patterns of Glyma19g40190
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g40190 not represented in the dataset
Glyma19g40190 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g40190
ParalogEvidenceComments
Glyma03g37570 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g40190 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g214300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g40190
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g40190
>Glyma19g40190.1   sequence type=CDS   gene model=Glyma19g40190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGGTATCTCAGTGGGTTTGAAGAAGTACTGGAGAAGAAGCATTAGGGGATACCAAAGATTACACGTCTCGGATCGGCGAAAGAAGGAAACGGTTCAGCTTGGAGGCAGCCAGAGAAGGAGGAGATGGCGCATAAAGTTAGCTCGTAAGATCAGAATTCCCAAAATCTCTTCTCCAAAGAAATTGGTGCTGTGGGTCAGAGACGCCTACGTCAGGATGATGCTGGGTATGGCTAACTCCATGGGTGCCTCCGCCGTCGGCTACGGCGGAGACGCCGCGTTCACCGCCAAGGGTGGATTCGAGAGGGCCCCACCGCCCAAGGAGTACGACCAGAAGATGATCATACATATGTACAAGTCCTTGATTATGGCACAGGGACAGTTGCTGCCGCGAGATTCAACACCCAAACCTGCCACAACAACAATGGTTACCACATTCTGA
Predicted protein sequences of Glyma19g40190
>Glyma19g40190.1   sequence type=predicted peptide   gene model=Glyma19g40190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGISVGLKKYWRRSIRGYQRLHVSDRRKKETVQLGGSQRRRRWRIKLARKIRIPKISSPKKLVLWVRDAYVRMMLGMANSMGASAVGYGGDAAFTAKGGFERAPPPKEYDQKMIIHMYKSLIMAQGQLLPRDSTPKPATTTMVTTF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo