Glyma19g40130 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g40130): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g40130): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g40130

Feature Type:	gene_model
Chromosome:	Gm19
Start:	46595514
stop:	46599898
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g40130

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G47490	AT	Annotation by Michelle Graham. TAIR10: NAD+ transporter 1 \| chr2:19487549-19489311 FORWARD LENGTH=312	SoyBase	E_val: 9.00E-161	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0006839	GO-bp	Annotation by Michelle Graham. GO Biological Process: mitochondrial transport	SoyBase	N/A	ISS
GO:0043132	GO-bp	Annotation by Michelle Graham. GO Biological Process: NAD transport	SoyBase	N/A	ISS
GO:0055085	GO-bp	Annotation by Michelle Graham. GO Biological Process: transmembrane transport	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005743	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane	SoyBase	N/A	ISS
GO:0031969	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast membrane	SoyBase	N/A	ISS
GO:0005215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transporter activity	SoyBase	N/A	ISS
GO:0051724	GO-mf	Annotation by Michelle Graham. GO Molecular Function: NAD transporter activity	SoyBase	N/A	ISS
KOG0764	KOG	Mitochondrial FAD carrier protein	JGI		ISS
PTHR24089	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24089:SF38	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00153	PFAM	Mitochondrial carrier protein	JGI		ISS
UniRef100_B9SAW7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial carrier protein, putative n=1 Tax=Ricinus communis RepID=B9SAW7_RICCO	SoyBase	E_val: 4.00E-179	ISS
UniRef100_I1NB98	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NB98_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma19g40130

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g40130 not represented in the dataset	Glyma19g40130 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g40130

Paralog	Evidence	Comments
Glyma03g37510	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g40130 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g213700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g40130

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g40130

Limit To All Plant Sequences

>Glyma19g40130.1   sequence type=CDS   gene model=Glyma19g40130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTGCCGACACCCACGCCGCTCCTAATATCAATCCCAAGGGCCTCCTCTGCAATGCCGCCGCCGGTGCTTCCGCCGGGGTTATTGCTGCTACATTTGTGTGTCCTTTAGATGTCATCAAAACTAGGTTTCAGGTTCACGGTGTCCCGCAGCTCGCGCATCGAAGTGCTAAAGGCAGCATAATAGTTGCTAGTTTGGAACAAGTGTTTCACAAGGAGGGATTACGTGGCATGTACCGTGGACTCGCGCCCACTGTGCTGGCTTTACTTCCAAATTGGGCGGTTTATTTTAGTGCATATGAGCAGCTTAAGAGCCTTCTTCAGTCTGATGATAGCCATCATCTTTCAATTGGAGCTAATATGATAGCTGCTTCTGGTGCTGGAGCTGCGACTACCATGTTTACAAATCCCCTTTGGGTTGTCAAGACTAGACTCCAAACACAGGGAATGAGACCTGGTGTTGTGCCATATAGGGGCACACTATCTGCATTGAGGAGAATTGCACACGAGGAGGGCATTCGAGGGCTGTACAGTGGCCTTGTTCCTGCTCTGGCTGGTATCAGTCATGTTGCCATCCAATTTCCTACATATGAGACAATAAAATTTTATTTGGCAAATCAAGATGACACAGCAATGGAAAAACTTGGTGCACGTGATGTTGCAATTGCATCATCAGTTTCCAAAATTTTTGCATCCACGTTGACATATCCTCATGAGGTTGTACGTTCCAGACTGCAAGAACAAGGGCATCATTCGGAGAAACGGTACTCTGGTGTGATTGATTGTATTAGAAAGGTTTTTCATCAAGAAGGTGTATCAGGCTTTTACCGAGGCTGTGCCACCAATCTTCTGAGGACAACGCCAGCTGCTGTGATTACATTCACCAGCTTTGAAATGATACACCGATTTCTTGTTTCTTATTTTCCTTCTGATCCACGGCCTCATATTTTGTGA

Predicted protein sequences of Glyma19g40130

Limit To All Plant Sequences

>Glyma19g40130.1   sequence type=predicted peptide   gene model=Glyma19g40130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTADTHAAPNINPKGLLCNAAAGASAGVIAATFVCPLDVIKTRFQVHGVPQLAHRSAKGSIIVASLEQVFHKEGLRGMYRGLAPTVLALLPNWAVYFSAYEQLKSLLQSDDSHHLSIGANMIAASGAGAATTMFTNPLWVVKTRLQTQGMRPGVVPYRGTLSALRRIAHEEGIRGLYSGLVPALAGISHVAIQFPTYETIKFYLANQDDTAMEKLGARDVAIASSVSKIFASTLTYPHEVVRSRLQEQGHHSEKRYSGVIDCIRKVFHQEGVSGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVSYFPSDPRPHIL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain