Glyma19g39780 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g39780

Feature Type:	gene_model
Chromosome:	Gm19
Start:	46330573
stop:	46333313
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g39780

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G27720	AT	Annotation by Michelle Graham. TAIR10: Small nuclear ribonucleoprotein family protein \| chr5:9815904-9817304 FORWARD LENGTH=129	SoyBase	E_val: 2.00E-55	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005732	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: small nucleolar ribonucleoprotein complex	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG3293	KOG	Small nuclear ribonucleoprotein (snRNP)	JGI		ISS
PTHR23338	Panther	SMALL NUCLEAR RIBONUCLEOPROTEIN SM	JGI		ISS
PF01423	PFAM	LSM domain	JGI		ISS
UniRef100_I1NB52	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NB52_SOYBN	SoyBase	E_val: 1.00E-99	ISS
UniRef100_Q43582	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Probable U6 snRNA-associated Sm-like protein LSm4 n=1 Tax=Nicotiana tabacum RepID=LSM4_TOBAC	SoyBase	E_val: 1.00E-72	ISS

Expression Patterns of Glyma19g39780

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g39780

Paralog	Evidence	Comments
Glyma03g37170	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g39780 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma19g39780

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g39780

Limit To All Plant Sequences

>Glyma19g39780.1   sequence type=CDS   gene model=Glyma19g39780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTCCTCTTTCCCTTCTCAAGACTGCCCAAGGCCACCCTATGTTGGTGGAACTGAAAAATGGGGAGACATATAACGGGCATTTGGTTAATTGCGATACATGGATGAACATCCATCTCCGAGAAGTCATTTGTACATCTAAAGACGGAGATAGATTTTGGAGGATGCCTGAATGCTATATACGAGGCAATACAATCAAGTACCTTCGAGTTCCTGATGAGGTTATTGACAAAGTTCAAGAAGAAACCAAGAGCCGTGCAGATCGCAAACCACCTGGAGTGGGACGTGGAAGGGGAAGAGGCAGAGAGGATGGTCCTGGTGGGCGCCCAGCAAAAGGAATTGGGCGTGGTCTTGATGATGGTGGTGCCAAGGGAGCTGGAGGAGGCCGAGGCAGGGGTGGTCCCAGTGGAAAGCCTGGTGGAAACAGAGGGCGAGGTAGAGGCTGA

Predicted protein sequences of Glyma19g39780

Limit To All Plant Sequences

>Glyma19g39780.1   sequence type=predicted peptide   gene model=Glyma19g39780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRGNTIKYLRVPDEVIDKVQEETKSRADRKPPGVGRGRGRGREDGPGGRPAKGIGRGLDDGGAKGAGGGRGRGGPSGKPGGNRGRGRG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain