Glyma19g39730 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g39730

Feature Type:	gene_model
Chromosome:	Gm19
Start:	46311867
stop:	46312860
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g39730

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G15800	AT	Annotation by Michelle Graham. TAIR10: ralf-like 33 \| chr4:8984915-8985265 FORWARD LENGTH=116	SoyBase	E_val: 5.00E-33	ISS
GO:0007267	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell-cell signaling	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0009505	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0004871	GO-mf	Annotation by Michelle Graham. GO Molecular Function: signal transducer activity	SoyBase	N/A	ISS
PF05498	PFAM	Rapid ALkalinization Factor (RALF)	JGI		ISS
UniRef100_C6T1Z2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T1Z2_SOYBN	SoyBase	E_val: 3.00E-80	ISS
UniRef100_G7KRV3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: RALF n=1 Tax=Medicago truncatula RepID=G7KRV3_MEDTR	SoyBase	E_val: 2.00E-53	ISS

Expression Patterns of Glyma19g39730

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g39730

Paralog	Evidence	Comments
Glyma03g37110	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g39730 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g209900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g39730

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g39730

Limit To All Plant Sequences

>Glyma19g39730.1   sequence type=CDS   gene model=Glyma19g39730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAAGTGTTACTTTTCTCCTGGCCTTGATCATGGTAGTAGCTTTGTCTATGTTTCCTTCCATAGTAGGTGCAATAGGGGAGCACCGGCTAAGGTGGGTGCTTAAGACAACAACACCATGCCAAGGCTCCATAGAAGAGTGCATGGCAGATGGTGAGTTTGGAATGGACTCAGAGTCTCACCGGCGCATTCTAGCAACCTCGCAGTATATAAGCTACAAGGCGCTGCAACGTAACACCGTGCCATGCTCTAGGAGGGGTGCTTCCTACTACAACTGCAAGCCAGGTGCAGATGCTAATCCTTACACTCGTGGCTGCCCCACCATCACTCGTTGCCGTAACTCTTAG

Predicted protein sequences of Glyma19g39730

Limit To All Plant Sequences

>Glyma19g39730.1   sequence type=predicted peptide   gene model=Glyma19g39730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSVTFLLALIMVVALSMFPSIVGAIGEHRLRWVLKTTTPCQGSIEECMADGEFGMDSESHRRILATSQYISYKALQRNTVPCSRRGASYYNCKPGADANPYTRGCPTITRCRNS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain