Report for Sequence Feature Glyma19g39440
Feature Type: gene_model
Chromosome: Gm19
Start: 46113104
stop: 46116283
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma19g39440
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G03180 AT
Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: rRNA processing (InterPro:IPR013730); Has 898 Blast hits to 687 proteins in 142 species: Archae - 2; Bacteria - 28; Metazoa - 200; Fungi - 99; Plants - 63; Viruses - 0; Other Eukaryotes - 506 (source: NCBI BLink). | chr4:1403289-1404663 FORWARD LENGTH=185
SoyBase E_val: 1.00E-42 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
KOG4851
KOG
Uncharacterized conserved protein
JGI ISS
PF08524 PFAM
rRNA processing
JGI ISS
UniRef100_I1NB14 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NB14_SOYBN
SoyBase E_val: 2.00E-155 ISS
UniRef100_Q2QP93 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Oryza sativa Japonica Group RepID=Q2QP93_ORYSJ
SoyBase E_val: 2.00E-31 ISS
Expression Patterns of Glyma19g39440
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma19g39440
Paralog Evidence Comments
Glyma03g36780 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma19g39440 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.19g206900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma19g39440
Coding sequences of Glyma19g39440
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma19g39440.1 sequence type=CDS gene model=Glyma19g39440 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGACGTGTCAGTATTTTATTATGTTTAGGGTAGTGTCCTCTAATTGTAATTGGTATACTCTGCAAATTGTTAGGGTTTGCACCTCAATTTCGGCGATGAAGAAGAACGACAAGGTACGCAGCGATAAGCAGAAACAAATAATGACGAAAAAGAAGAACATTTCGAGGTTGGGTGGAAGTGGCCTTTCGCTCGACGCTTTCGCCAACGCAAAATCCAAGAACAATCTCTATAACCCAGCCATCATAAAGAAGCAAAGGGAGTTCTATAAAAATGCTAAGAATGTGAATAAGTTTAAGAAGTTGGTAAAGCAGCAAAACCAGCAAAATGATCCCTCCTTGGCTCAGAGACTTAAAGAGAATGTAAATGAAACTGAAGAGAACAAGGACAAGAGTGAGAGGAGGAAGAGGAAGAATAGCGCCCTTAGTTTGGAAGAGTTGTACAAGAAGCAGCATGAAGAGAAAGAGAAAGAAAGAATGGAGAAAGAGGCTGTCCTGAGGGTAAAGAAGGAAGACAGAGAACAAGCTGAAGCTCAGAGAAAGGCTATGCGAGAAAAAATGCTTAAGAAGACACGAAAAGGGCAGCCTGTTATGAAATACAGAATTGAGCATCTTTTGGAGACTATTCAAGGCTCAACTAAAAGCAGCTGCCAGTAA
Predicted protein sequences of Glyma19g39440
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma19g39440.1 sequence type=predicted peptide gene model=Glyma19g39440 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MTCQYFIMFRVVSSNCNWYTLQIVRVCTSISAMKKNDKVRSDKQKQIMTKKKNISRLGGSGLSLDAFANAKSKNNLYNPAIIKKQREFYKNAKNVNKFKKLVKQQNQQNDPSLAQRLKENVNETEENKDKSERRKRKNSALSLEELYKKQHEEKEKERMEKEAVLRVKKEDREQAEAQRKAMREKMLKKTRKGQPVMKYRIEHLLETIQGSTKSSCQ*