SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g39240): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g39240): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g39240

Feature Type:gene_model
Chromosome:Gm19
Start:45992258
stop:45994132
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G09690AT Annotation by Michelle Graham. TAIR10: Translation protein SH3-like family protein | chr1:3136407-3137430 REVERSE LENGTH=164 SoyBaseE_val: 1.00E-102ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG1732 KOG 60S ribosomal protein L21 JGI ISS
PTHR20981Panther 60S RIBOSOMAL PROTEIN L21 JGI ISS
PF01157PFAM Ribosomal protein L21e JGI ISS
UniRef100_C6SZS1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SZS1_SOYBN SoyBaseE_val: 4.00E-116ISS
UniRef100_G8A186UniRef Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L21 n=1 Tax=Medicago truncatula RepID=G8A186_MEDTR SoyBaseE_val: 7.00E-110ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g39240 not represented in the dataset

Glyma19g39240 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma03g36560 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g205000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g39240.1   sequence type=CDS   gene model=Glyma19g39240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCGGCTGGTCATGGTTTGAGATCCCGCACCAGAGATTCCTTCTCTCGTCCTTTCAGGAAGAAGGGAACCATCGCCCTCACCACATACCTGAGAACCTACCACGTCGGCGACTATGTTGACGTCAAGGTTAACGGTGCCGTTCACAAGGGAATGCCCCACAAATTCTACCATGGCCGCACCGGACGCGTCTGGAATGTCACCAAACGTGCTGTTGGCGTCGAAGTCAACAAGCAGGTTGGCAACAGAATTATAAGGAAGAGGATTCATGTGCGGGTAGAGCATGTTATGCCTTCAAGGTGCACTGAGGAGTTCCGCCTCAGGAAGATTAAGAATGATCAGCTAAAGGCCGAAGCCAAGGTCAAGGGTGAGAAGATCAGCACCAAGAGACAGCCTCAGGGTCCCAAACCCGGTTTCATGGTGGAGGGTGCGACCCTTGAGACAGTTACCCCCATCCCATATGATGTTGTCAATGACCTCAAGGGAGGTTATTAG

>Glyma19g39240.1   sequence type=predicted peptide   gene model=Glyma19g39240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPAGHGLRSRTRDSFSRPFRKKGTIALTTYLRTYHVGDYVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAVGVEVNKQVGNRIIRKRIHVRVEHVMPSRCTEEFRLRKIKNDQLKAEAKVKGEKISTKRQPQGPKPGFMVEGATLETVTPIPYDVVNDLKGGY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo