Report for Sequence Feature Glyma19g38980
Feature Type: gene_model
Chromosome: Gm19
Start: 45805533
stop: 45806326
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma19g38980
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
PF05678 PFAM
VQ motif
JGI ISS
UniRef100_B6SZE5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: VQ motif family protein n=1 Tax=Zea mays RepID=B6SZE5_MAIZE
SoyBase E_val: 2.00E-07 ISS
UniRef100_I1NAX0 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NAX0_SOYBN
SoyBase E_val: 7.00E-84 ISS
Proteins Associated with Glyma19g38980
Locus Gene Symbol Protein Name
VQ71 VQ motif containing protein gene 71
Expression Patterns of Glyma19g38980
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma19g38980
Paralog Evidence Comments
Glyma03g36330 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma19g38980 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.19g202300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma19g38980
Coding sequences of Glyma19g38980
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma19g38980.1 sequence type=CDS gene model=Glyma19g38980 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAATTCCCAAGCAGCAAGCAGACACAAGCAGTTGCAGGGTCCAAAGCCTGCTTCTCTAATTATTAACAGAAACTCCACAAAGATCAGTAAGCAGAAGCAGCACCTCTCACATCATTCACCAGTTATAGTGCATTTGAAATCTCCCAAGGTCATTCACGTCAGGCCTGAAGAATTTATGAGTCTCGTGCAGCAGCTAACTGGGAACCCCGTATCTGCAGCTGCTGTTGCTGCCAATTCTCCAAAAATGGAGAAGAGTAGCACCGTTGCAGCCATGGATGAAAACCCAGTAGAGGATTTTATTGGTAGCCTAGGGCGTACTGCCAATATTTCAGTTGATTTCCAAGCTTTAATGCACTTTGTAGATTTTGTATAA
Predicted protein sequences of Glyma19g38980
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma19g38980.1 sequence type=predicted peptide gene model=Glyma19g38980 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MNSQAASRHKQLQGPKPASLIINRNSTKISKQKQHLSHHSPVIVHLKSPKVIHVRPEEFMSLVQQLTGNPVSAAAVAANSPKMEKSSTVAAMDENPVEDFIGSLGRTANISVDFQALMHFVDFV*