SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma19g38980

Feature Type:gene_model
Chromosome:Gm19
Start:45805533
stop:45806326
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
PF05678PFAM VQ motif JGI ISS
UniRef100_B6SZE5UniRef Annotation by Michelle Graham. Most informative UniRef hit: VQ motif family protein n=1 Tax=Zea mays RepID=B6SZE5_MAIZE SoyBaseE_val: 2.00E-07ISS
UniRef100_I1NAX0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NAX0_SOYBN SoyBaseE_val: 7.00E-84ISS

LocusGene SymbolProtein Name
VQ71 VQ motif containing protein gene 71

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma03g36330 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g202300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g38980.1   sequence type=CDS   gene model=Glyma19g38980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATTCCCAAGCAGCAAGCAGACACAAGCAGTTGCAGGGTCCAAAGCCTGCTTCTCTAATTATTAACAGAAACTCCACAAAGATCAGTAAGCAGAAGCAGCACCTCTCACATCATTCACCAGTTATAGTGCATTTGAAATCTCCCAAGGTCATTCACGTCAGGCCTGAAGAATTTATGAGTCTCGTGCAGCAGCTAACTGGGAACCCCGTATCTGCAGCTGCTGTTGCTGCCAATTCTCCAAAAATGGAGAAGAGTAGCACCGTTGCAGCCATGGATGAAAACCCAGTAGAGGATTTTATTGGTAGCCTAGGGCGTACTGCCAATATTTCAGTTGATTTCCAAGCTTTAATGCACTTTGTAGATTTTGTATAA

>Glyma19g38980.1   sequence type=predicted peptide   gene model=Glyma19g38980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNSQAASRHKQLQGPKPASLIINRNSTKISKQKQHLSHHSPVIVHLKSPKVIHVRPEEFMSLVQQLTGNPVSAAAVAANSPKMEKSSTVAAMDENPVEDFIGSLGRTANISVDFQALMHFVDFV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo